(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE448

CAGLA1_12.PE448      Location/Qualifiers
FT   CDS             1025157..1025570
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349530"
FT                   /locus_tag="CAGL0M10241g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62770.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG166121"
FT                   /db_xref="HOGENOM:HBG499844"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI00003B7195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ02"
FT                   /transl_table=1
FT                   /translation="MSSTTVRNSNWRLVEVGRVVLVKKGQSAGKLAAIVEIIDQKQVLI
FT                   DGPETGVPRQSINLGQVVLTPLTFTLPRGARTSIVSKKWAAAQVTESWKASSWAKKIAQ
FT                   RERRSALSDFERFQVMVLKKQKRYTVKKALAKA"
     MSSTTVRNSN WRLVEVGRVV LVKKGQSAGK LAAIVEIIDQ KQVLIDGPET GVPRQSINLG        60
     QVVLTPLTFT LPRGARTSIV SKKWAAAQVT ESWKASSWAK KIAQRERRSA LSDFERFQVM       120
     VLKKQKRYTV KKALAKA                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page