(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE451

CAGLA1_12.PE451      Location/Qualifiers
FT   CDS             1032001..1033347
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501707"
FT                   /locus_tag="CAGL0M10307g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62773.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058159"
FT                   /db_xref="HOGENOM:HBG397262"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI00003B7198"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ9"
FT                   /transl_table=1
FT                   /translation="MFLKVRDWFLKDRPANHSATDLEYGWNPMESVRYLRSQYRHYKAN
FT                   PHLLSYKDVCHYTFMGSVWLFVLIMNPAPMVLKLLFYAFLTLLFLVPITSQFFFNALPI
FT                   LTWLALYFTSSYLKADIRPPITVKALPAIETVLYGDNLSDILATSTNPVLDIFAWIPYG
FT                   LFHFGAPFVVALILFLFGPPTILKGYAFAFGYMNLIGVMIQNFFPAAPPWYKILYGLES
FT                   ANYTMKGSPGGLARIDELLHINLYSNAFANSSVIFGAFPSLHSGCATMEALFFSYCFPF
FT                   LRPLFIFYVCWLWWSTMYLTHHYFVDLMAGSVLSYVIFQYTKYYHLPVVNTSYLTRWAY
FT                   PSVSKYDFKTSDPLNTDSEMHVENIPLRTYDETMSIDSRSNSNGRLELELDMDMDNMRT
FT                   VSSNTSTPASVFDRMESLSRSSATSNTSLGNLSTTDLTDPPVARKPSAF"
     MFLKVRDWFL KDRPANHSAT DLEYGWNPME SVRYLRSQYR HYKANPHLLS YKDVCHYTFM        60
     GSVWLFVLIM NPAPMVLKLL FYAFLTLLFL VPITSQFFFN ALPILTWLAL YFTSSYLKAD       120
     IRPPITVKAL PAIETVLYGD NLSDILATST NPVLDIFAWI PYGLFHFGAP FVVALILFLF       180
     GPPTILKGYA FAFGYMNLIG VMIQNFFPAA PPWYKILYGL ESANYTMKGS PGGLARIDEL       240
     LHINLYSNAF ANSSVIFGAF PSLHSGCATM EALFFSYCFP FLRPLFIFYV CWLWWSTMYL       300
     THHYFVDLMA GSVLSYVIFQ YTKYYHLPVV NTSYLTRWAY PSVSKYDFKT SDPLNTDSEM       360
     HVENIPLRTY DETMSIDSRS NSNGRLELEL DMDMDNMRTV SSNTSTPASV FDRMESLSRS       420
     SATSNTSLGN LSTTDLTDPP VARKPSAF                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page