(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE46

CAGLA1_12.PE46       Location/Qualifiers
FT   CDS             complement(123429..127094)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436699"
FT                   /locus_tag="CAGL0M01144g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAG62370.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG058987"
FT                   /db_xref="HOGENOM:HBG397066"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B700C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK50"
FT                   /transl_table=1
FT                   /translation="MNVGANQVVEALNVIYSPKSNNGQRLEAQKFLDSVRTLEESPLWG
FT                   FEIALNNSDNNILKYFGLNLLEYNIKKNWNSYNNEKRQQLKKWIIELNYNVSTVDTRYI
FT                   KEKLASLWVEIAKRIWGEALKETNPSNDQLLDSWVDLDRDLHQLWNINESSREVTLIIF
FT                   RILFEDVFLLDDMTVLKRMTIIQPLCVMIVCPMDIFITKYKFSEKWTLFKADSDGWFSI
FT                   WIPELRTALLNKNSEYIIRLLETLKTCLNWPLSEVIIKNDILTTLLDCLATDIRKAQSM
FT                   ALDSIHILLTRPYGNDEHYQTIIDKVFDSMDLLARVYEDLLFNPEEEVDETRYPIVKKF
FT                   VDMTSCLYVSIPKIKDTNNQIEKYFKLVMQTTYNPSLIVSGLTLDLWCSCLRNDDYIPL
FT                   IQKYAIKDLLNFAADALVYYEQIDGHISRNYVDIDFQSNSEFQSYCSTYRKRIRDIIRL
FT                   ISCVEIDMTYEWLNNRLNVYFSSPAGQQVLTSSFLDHKSEPYLGALSQYMIVECFINGC
FT                   IRWKIWYPSGPDYNQKLDSILQKLEILSNQLIALNMKEPLLLKKQIQNFALFLTMLRDN
FT                   VLFTLLEKIITSATMDYPEVNLDDRSEQSDAVRDLRYACGIELNRMALLMPESLKSIYP
FT                   DLEAVIAKIMPNLSYHEKISFKSFLLIIVLKSSLDNKEQRFSELVDVELMAWSEKTTEV
FT                   GLSDLHWFMERLGIVQIAEYFQKRGINENSDLLTIPIDDEGRALKAELTKRWQTLFPVR
FT                   ATRMFIHYSMQSIKGDEEFKRLQDLWRPRIIPVLPYILRLLFQLQSYHDAENWKNLPVI
FT                   VQTFVKCTTVERFWEAGASSKSKDEFIDEHMKAMQTLRDFADSVGHIIRYTREYTLLVL
FT                   SAISSLGSIFFELDDVPDMLINSIAIFKPGNNEISPGVSTHGWKHILNIAIRPMLKNCP
FT                   DDCAPKFMSAFLPKLFEMLDHLLYQRWSVRMDVMDVNPAPVDNDQMTEDILEENLLRQL
FT                   TTVVVRIVIDCVGQASVSSQSARSNLTSHQLRMRKIIFNDINILAPFLKLVNHLMAYKD
FT                   NKCSFNSILVMKGCINEVAAKDETVDVFFTTELMKNLLINVLCNSAFKDFFNEALYVFT
FT                   TLFLTLCKESTSARQFFYELSGGYDIDSLHSNLKKVDDYKSQRALMVEFIDWTKMTLGK
FT                   DDFDEEQAMQENRKQEKREAILQKANERLIKKNKESGDMLDDPNTEDGAVGNLFS"
     MNVGANQVVE ALNVIYSPKS NNGQRLEAQK FLDSVRTLEE SPLWGFEIAL NNSDNNILKY        60
     FGLNLLEYNI KKNWNSYNNE KRQQLKKWII ELNYNVSTVD TRYIKEKLAS LWVEIAKRIW       120
     GEALKETNPS NDQLLDSWVD LDRDLHQLWN INESSREVTL IIFRILFEDV FLLDDMTVLK       180
     RMTIIQPLCV MIVCPMDIFI TKYKFSEKWT LFKADSDGWF SIWIPELRTA LLNKNSEYII       240
     RLLETLKTCL NWPLSEVIIK NDILTTLLDC LATDIRKAQS MALDSIHILL TRPYGNDEHY       300
     QTIIDKVFDS MDLLARVYED LLFNPEEEVD ETRYPIVKKF VDMTSCLYVS IPKIKDTNNQ       360
     IEKYFKLVMQ TTYNPSLIVS GLTLDLWCSC LRNDDYIPLI QKYAIKDLLN FAADALVYYE       420
     QIDGHISRNY VDIDFQSNSE FQSYCSTYRK RIRDIIRLIS CVEIDMTYEW LNNRLNVYFS       480
     SPAGQQVLTS SFLDHKSEPY LGALSQYMIV ECFINGCIRW KIWYPSGPDY NQKLDSILQK       540
     LEILSNQLIA LNMKEPLLLK KQIQNFALFL TMLRDNVLFT LLEKIITSAT MDYPEVNLDD       600
     RSEQSDAVRD LRYACGIELN RMALLMPESL KSIYPDLEAV IAKIMPNLSY HEKISFKSFL       660
     LIIVLKSSLD NKEQRFSELV DVELMAWSEK TTEVGLSDLH WFMERLGIVQ IAEYFQKRGI       720
     NENSDLLTIP IDDEGRALKA ELTKRWQTLF PVRATRMFIH YSMQSIKGDE EFKRLQDLWR       780
     PRIIPVLPYI LRLLFQLQSY HDAENWKNLP VIVQTFVKCT TVERFWEAGA SSKSKDEFID       840
     EHMKAMQTLR DFADSVGHII RYTREYTLLV LSAISSLGSI FFELDDVPDM LINSIAIFKP       900
     GNNEISPGVS THGWKHILNI AIRPMLKNCP DDCAPKFMSA FLPKLFEMLD HLLYQRWSVR       960
     MDVMDVNPAP VDNDQMTEDI LEENLLRQLT TVVVRIVIDC VGQASVSSQS ARSNLTSHQL      1020
     RMRKIIFNDI NILAPFLKLV NHLMAYKDNK CSFNSILVMK GCINEVAAKD ETVDVFFTTE      1080
     LMKNLLINVL CNSAFKDFFN EALYVFTTLF LTLCKESTSA RQFFYELSGG YDIDSLHSNL      1140
     KKVDDYKSQR ALMVEFIDWT KMTLGKDDFD EEQAMQENRK QEKREAILQK ANERLIKKNK      1200
     ESGDMLDDPN TEDGAVGNLF S                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page