(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE47

CAGLA1_12.PE47       Location/Qualifiers
FT   CDS             131016..131990
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000106048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436700"
FT                   /locus_tag="CAGL0M01166g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="CAG62371.1"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG056531"
FT                   /db_xref="HOGENOM:HBG325902"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="UniParc:UPI00003B700D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK49"
FT                   /transl_table=1
FT                   /translation="MSATATTTTTSQLQLNSTSIEHALSDVVKTDDWSDFQFRPIREST
FT                   VSRAMTSRYFKDLDKFAVSDVVIIGCGSSGLSAAYVIAKNRPDLKIAILEANVAPGGGA
FT                   WLGGQLFSAMIMRKPADLFLKELEIPYEDEGDYVVVKHAALFTSTVLSKVLQFPNVKLF
FT                   NATAVEDLVTRPAGPNGEVSVAGVVTNWTLVTMAHDLQSCMDPNVIELSGYKEDGTRDP
FT                   SKKHGVVLSTTGHDGPFGAFSAKRIVSIDKNKKLAGMKGLDMNNAEAGVVKNSGSYNGV
FT                   GSMYFAGMEVAELEGCNRMGPTFGAMAVSGIKAGEEILKHFAE"
     MSATATTTTT SQLQLNSTSI EHALSDVVKT DDWSDFQFRP IRESTVSRAM TSRYFKDLDK        60
     FAVSDVVIIG CGSSGLSAAY VIAKNRPDLK IAILEANVAP GGGAWLGGQL FSAMIMRKPA       120
     DLFLKELEIP YEDEGDYVVV KHAALFTSTV LSKVLQFPNV KLFNATAVED LVTRPAGPNG       180
     EVSVAGVVTN WTLVTMAHDL QSCMDPNVIE LSGYKEDGTR DPSKKHGVVL STTGHDGPFG       240
     AFSAKRIVSI DKNKKLAGMK GLDMNNAEAG VVKNSGSYNG VGSMYFAGME VAELEGCNRM       300
     GPTFGAMAVS GIKAGEEILK HFAE                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page