(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE49

CAGLA1_12.PE49       Location/Qualifiers
FT   CDS             complement(137725..138729)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094409" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436701"
FT                   /gene_name="IPI1"
FT                   /locus_tag="CAGL0M01210g"
FT                   /product="Pre-rRNA-processing protein IPI1 "
FT                   /function="binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62373.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG058844"
FT                   /db_xref="HOGENOM:HBG397966"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B700F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK47"
FT                   /transl_table=1
FT                   /translation="MTKSKKQKQKKKDFLKKKLKVGKPTGKPSNSTDTSFTARTLSVRS
FT                   QLVNNAGDDLRKRLPLLKHHNDKVRKETLGIYIKAIPKIISTQLMTPLISQTSQLICDD
FT                   SKDVREQLLELFDEVGKHDEQVLKLHCRSLVLYINMGMTHILPRVQADSTKFLGCLLKY
FT                   CGQEFCDQAWNKLMAGIFRVLSWETQHSKNSNQAAGAMQTSKRDNKFQAAHLSTLYALL
FT                   ECGCKEPTVETTDEDTTSNIQNFEEVQYMTPSFPQAYGYLKLFDKQLKSSSSNKDNSSV
FT                   SSSDALDVESRIRNVENVYLPTMKKQIEQIIQEGGEAGKNANNIKKLISEIFS"
     MTKSKKQKQK KKDFLKKKLK VGKPTGKPSN STDTSFTART LSVRSQLVNN AGDDLRKRLP        60
     LLKHHNDKVR KETLGIYIKA IPKIISTQLM TPLISQTSQL ICDDSKDVRE QLLELFDEVG       120
     KHDEQVLKLH CRSLVLYINM GMTHILPRVQ ADSTKFLGCL LKYCGQEFCD QAWNKLMAGI       180
     FRVLSWETQH SKNSNQAAGA MQTSKRDNKF QAAHLSTLYA LLECGCKEPT VETTDEDTTS       240
     NIQNFEEVQY MTPSFPQAYG YLKLFDKQLK SSSSNKDNSS VSSSDALDVE SRIRNVENVY       300
     LPTMKKQIEQ IIQEGGEAGK NANNIKKLIS EIFS                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page