(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE5

CAGLA1_12.PE5        Location/Qualifiers
FT   CDS             28137..30434
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435639"
FT                   /locus_tag="CAGL0M00220g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="mannosyltransferase activity"
FT                   /biological_process="protein O-linked glycosylation "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62330.1"
FT                   /db_xref="GO:0000030"
FT                   /db_xref="GO:0006493"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG026546"
FT                   /db_xref="HOGENOM:HBG328830"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniParc:UPI00003B6FE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK90"
FT                   /transl_table=1
FT                   /translation="MAVTKRSPGTKKFGSSASKESSVDVDDVSLKYNKGVAATEQLAQN
FT                   WLLNPKPDSDNSYRLGFYLVTAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFF
FT                   DVHPPLAKMMIAFIGWLCNYDGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMF
FT                   ESMKELNFKAITCFLASMLVAIDNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLK
FT                   EPFSWNWYIWLYLTGFSLSCVISTKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLI
FT                   KHIGRRLNGLILIPFIIYLFWFYVHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEV
FT                   QFFDIVTFENQDTGAFLHSHLARYPLRYEDDRVSSQGQQVTCYTHEDVNNQWEILPVAD
FT                   KAKGDNIRFGDEFRLRHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFR
FT                   FQPINKKDEGHIIKSKNAVLRIIHKETVVALWSHNDELLPDWGFGQQEVNGNKKMTDSG
FT                   NAWTIDSIMNLDEKRSAYAPKEIKSMPFFNKWLELQKLMFEQNNKLTSEHPFASQPESW
FT                   PGSMSGVSFWTKNEERRQIYFIGNIIGFWFQVISFAVYVGIIIADQITRQRGYFALNKV
FT                   TREKLYGPLAYLFCGWACHYFPFFLMGRQKFLHHYLPAHLIAALFAAGLWETVFSRCKS
FT                   DDPYKDEEKPGVSFEKYPAIYTAAYITFNITVLAALVWCFVFFSPLIYATPLSAREVIK
FT                   RKWLDISLSFAK"
     MAVTKRSPGT KKFGSSASKE SSVDVDDVSL KYNKGVAATE QLAQNWLLNP KPDSDNSYRL        60
     GFYLVTAIAF AVRFYKIYYP REVVFDEVHF GKFASYYLER TFFFDVHPPL AKMMIAFIGW       120
     LCNYDGSFKF EEIGLSYDKH PAPFLAYRSF NALLGTLTVS IMFESMKELN FKAITCFLAS       180
     MLVAIDNAHV TETRLILLDA ILLISVAATV YSYIRFYKLQ LKEPFSWNWY IWLYLTGFSL       240
     SCVISTKYIG VMTYAAIGIP VVVNLWQLLD INAKLSIRML IKHIGRRLNG LILIPFIIYL       300
     FWFYVHFAIL NVSGPGDVFM SSEFQDTLHD SEATKLSKEV QFFDIVTFEN QDTGAFLHSH       360
     LARYPLRYED DRVSSQGQQV TCYTHEDVNN QWEILPVADK AKGDNIRFGD EFRLRHVGTD       420
     SYLLAHDVAS PLYPTNEEIT TVHKDDALGA RANSTIFRFQ PINKKDEGHI IKSKNAVLRI       480
     IHKETVVALW SHNDELLPDW GFGQQEVNGN KKMTDSGNAW TIDSIMNLDE KRSAYAPKEI       540
     KSMPFFNKWL ELQKLMFEQN NKLTSEHPFA SQPESWPGSM SGVSFWTKNE ERRQIYFIGN       600
     IIGFWFQVIS FAVYVGIIIA DQITRQRGYF ALNKVTREKL YGPLAYLFCG WACHYFPFFL       660
     MGRQKFLHHY LPAHLIAALF AAGLWETVFS RCKSDDPYKD EEKPGVSFEK YPAIYTAAYI       720
     TFNITVLAAL VWCFVFFSPL IYATPLSARE VIKRKWLDIS LSFAK                       765
//

If you have problems or comments...

PBIL Back to PBIL home page