(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE53

CAGLA1_12.PE53       Location/Qualifiers
FT   CDS             complement(147015..148187)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204398" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436703"
FT                   /locus_tag="CAGL0M01298g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG62377.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG351228"
FT                   /db_xref="HOGENOM:HBG561734"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="UniParc:UPI00003B7013"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK43"
FT                   /transl_table=1
FT                   /translation="MRIVLPCLLWLVTLACGVVNAEHTNNWAVLVSTSRFWFNYRHMAN
FT                   VLSMYRTVRRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNKDHAIDLYGESVEVDYRG
FT                   YEVTVENFIRLLTDRWTEDQPKSKRLQTDENSNIFIYLTGHGGDDFLKFQDAEEIASED
FT                   IADAFAQMYEKKRYNEIFFMIDTCQANTMYSKFYSPNVLAVGSSELDESSYSHHSDVEI
FT                   GVAVIDRFTYYSLEFLEQIDKTSNLTLKDLFDSYTFEKVHSHVGVRSDLFKRNVSDVLI
FT                   TDFFANVQNVIPDDNSGKTSGNNEDIIDLAIQKSQLASKKDKSSQTPKPKEPASSIYFR
FT                   TASSLNKNITDAKNNSNEGLMTVLLIILVMLGLYTTFKRTSKKETAKFSL"
     MRIVLPCLLW LVTLACGVVN AEHTNNWAVL VSTSRFWFNY RHMANVLSMY RTVRRLGIPD        60
     SQIILMLSDD VACNSRNLFP GSVFNNKDHA IDLYGESVEV DYRGYEVTVE NFIRLLTDRW       120
     TEDQPKSKRL QTDENSNIFI YLTGHGGDDF LKFQDAEEIA SEDIADAFAQ MYEKKRYNEI       180
     FFMIDTCQAN TMYSKFYSPN VLAVGSSELD ESSYSHHSDV EIGVAVIDRF TYYSLEFLEQ       240
     IDKTSNLTLK DLFDSYTFEK VHSHVGVRSD LFKRNVSDVL ITDFFANVQN VIPDDNSGKT       300
     SGNNEDIIDL AIQKSQLASK KDKSSQTPKP KEPASSIYFR TASSLNKNIT DAKNNSNEGL       360
     MTVLLIILVM LGLYTTFKRT SKKETAKFSL                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page