(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE55

CAGLA1_12.PE55       Location/Qualifiers
FT   CDS             150584..152002
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436704"
FT                   /locus_tag="CAGL0M01342g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="integral to peroxisomal membrane "
FT                   /protein_id="CAG62379.1"
FT                   /db_xref="GO:0005779"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="HOGENOM:HBG203255"
FT                   /db_xref="HOGENOM:HBG540659"
FT                   /db_xref="InterPro:IPR006966"
FT                   /db_xref="UniParc:UPI00003B7015"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK41"
FT                   /transl_table=1
FT                   /translation="MVQGRAPVSRRVQRYRGGLFIAAASVGTLVAVGSLAVYIVKQWLY
FT                   RQQLRIAEEHFVKEQIKRRFDQTQSDSLATLYELVQVSSMVYDQKDLNLDEIMLALRDK
FT                   KLQKQSQTGSAARAADTTSNSSVTGVTSALNDKVSEKASSIRSSKTDDIRNMTKGELWN
FT                   QLKIRSISKLVTVTYTTSCLLLMTRLQLNILTRKEYLETVVKTTMQKNNDAGNSSGFFS
FT                   WVASKIWGSPSNGEEKRKSAQDMYGELVQAEKAGKHMSKGKVEYINEQAFLSIFWWLIN
FT                   RGWSKIHEIVEREVRSEFGHLDPKDALTIDDFSERLTKVYYRVNKTLFLVNEEKEKPLL
FT                   DIMIPRTPQELKNVLEQAMDLESLQLLEQDDSILRQLCKEMEKYMKSEATSIVMEQAIN
FT                   ESFDYAITEIDASIKKRNQEETQMALFALSCKECCDKMLKTNMMTMDNDYLTVLDGIAV
FT                   LDDLSAMVYSNFGL"
     MVQGRAPVSR RVQRYRGGLF IAAASVGTLV AVGSLAVYIV KQWLYRQQLR IAEEHFVKEQ        60
     IKRRFDQTQS DSLATLYELV QVSSMVYDQK DLNLDEIMLA LRDKKLQKQS QTGSAARAAD       120
     TTSNSSVTGV TSALNDKVSE KASSIRSSKT DDIRNMTKGE LWNQLKIRSI SKLVTVTYTT       180
     SCLLLMTRLQ LNILTRKEYL ETVVKTTMQK NNDAGNSSGF FSWVASKIWG SPSNGEEKRK       240
     SAQDMYGELV QAEKAGKHMS KGKVEYINEQ AFLSIFWWLI NRGWSKIHEI VEREVRSEFG       300
     HLDPKDALTI DDFSERLTKV YYRVNKTLFL VNEEKEKPLL DIMIPRTPQE LKNVLEQAMD       360
     LESLQLLEQD DSILRQLCKE MEKYMKSEAT SIVMEQAINE SFDYAITEID ASIKKRNQEE       420
     TQMALFALSC KECCDKMLKT NMMTMDNDYL TVLDGIAVLD DLSAMVYSNF GL               472
//

If you have problems or comments...

PBIL Back to PBIL home page