(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE56

CAGLA1_12.PE56       Location/Qualifiers
FT   CDS             153430..153969
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500873"
FT                   /gene_name="CBF3d"
FT                   /locus_tag="CAGL0M01364g"
FT                   /product="Centromere binding factor 3d "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAG62380.1"
FT                   /db_xref="EMBL:AAD56717.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG360223"
FT                   /db_xref="HOGENOM:HBG622018"
FT                   /db_xref="HSSP:1NEX"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016072"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR016897"
FT                   /db_xref="UniParc:UPI000006A355"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UVW8"
FT                   /transl_table=1
FT                   /translation="MDKKGKYVVLVSGEGEKFTVEKKIAQRSLLLKNYLNDMHESSLDD
FT                   EDEEQDEDEDEDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDAW
FT                   DREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTP
FT                   EEEAAIRRENEWAEDR"
     MDKKGKYVVL VSGEGEKFTV EKKIAQRSLL LKNYLNDMHE SSLDDEDEEQ DEDEDEDDEI        60
     VMPVPNVRSS VLQKVIEWAE HHRDSNFPDE DDDDSRKSAP VDAWDREFLK VDQEMLYEII       120
     LAANYLNIKP LLDAGCKVVA EMIRGRSPEE IRRTFNIVND FTPEEEAAIR RENEWAEDR        179
//

If you have problems or comments...

PBIL Back to PBIL home page