(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE60

CAGLA1_12.PE60       Location/Qualifiers
FT   CDS             167313..168917
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001058" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436708"
FT                   /locus_tag="CAGL0M01452g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62384.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG060085"
FT                   /db_xref="HOGENOM:HBG203254"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR021565"
FT                   /db_xref="UniParc:UPI00003B7019"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK36"
FT                   /transl_table=1
FT                   /translation="MQSSDVRPNDTQQEYSKLIQEENTKSSCPICFKECANLNELNKHL
FT                   DKDHNFGNENSNGDHVKKHQNKKKSSGIRTSHHEVYNEGMSKCAYCRKKLTKSNGVSNC
FT                   YHCGKLYCRSHLLWQMKLDKRARYDPQHGKFYPCCFKCTSSRPGYNDYGLTVSKTSEFS
FT                   RLRSSKMEDKQLRSLQLETRLLKLIDGYISISRKYGNNLFSTVVRNSELSKYERSIVHW
FT                   KDDSNVHTCNICTSEFGLVRLSRKHHCRLCGNIVCDTDGYEEEVINTRRRKTTMKKCSY
FT                   QIKLRNLKSSTDDLHYNSQLRPDEEYIAELQVRLCSTCIDNLLLKRKFKRDLTKPMPPL
FT                   LSRYETLHNIADVIRTILPPFQDALQKIDNERTKKVSDEKELADLSKLRVKLLRSFANY
FT                   NSVNKQLCSIKPSNFSEERVKNSLLVESSYFINENILPLRSLPAVLSGEDYVMSKSEPE
FT                   VKKLSELMSSDLSIKEIKQGREELMVLEEQIFQIESLVETAKRQRKFDEVATLATNLNE
FT                   LNQRATELREKLGQEGF"
     MQSSDVRPND TQQEYSKLIQ EENTKSSCPI CFKECANLNE LNKHLDKDHN FGNENSNGDH        60
     VKKHQNKKKS SGIRTSHHEV YNEGMSKCAY CRKKLTKSNG VSNCYHCGKL YCRSHLLWQM       120
     KLDKRARYDP QHGKFYPCCF KCTSSRPGYN DYGLTVSKTS EFSRLRSSKM EDKQLRSLQL       180
     ETRLLKLIDG YISISRKYGN NLFSTVVRNS ELSKYERSIV HWKDDSNVHT CNICTSEFGL       240
     VRLSRKHHCR LCGNIVCDTD GYEEEVINTR RRKTTMKKCS YQIKLRNLKS STDDLHYNSQ       300
     LRPDEEYIAE LQVRLCSTCI DNLLLKRKFK RDLTKPMPPL LSRYETLHNI ADVIRTILPP       360
     FQDALQKIDN ERTKKVSDEK ELADLSKLRV KLLRSFANYN SVNKQLCSIK PSNFSEERVK       420
     NSLLVESSYF INENILPLRS LPAVLSGEDY VMSKSEPEVK KLSELMSSDL SIKEIKQGRE       480
     ELMVLEEQIF QIESLVETAK RQRKFDEVAT LATNLNELNQ RATELREKLG QEGF             534
//

If you have problems or comments...

PBIL Back to PBIL home page