(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE61

CAGLA1_12.PE61       Location/Qualifiers
FT   CDS             170175..170609
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044345"
FT                   /locus_tag="CAGL0M01474g"
FT                   /product="Similar to uniprot|Q92317 Saccharomyces
FT                   cerevisiae YDR397c YNC2beta"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62385.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B701A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK35"
FT                   /transl_table=1
FT                   /translation="MIGDGDDVTLPKATVQKIISEVLDSDLMFNRDAREIIIKSGIEFI
FT                   MILSSMASEMAESDAKKTIAPEHVIKALKELEYNEFIPLLEQILIEFKGTQKIKEKKNS
FT                   KFKKSGLTEEELLQQQEELFRKSRSRLHQNSVSGSATDST"
     MIGDGDDVTL PKATVQKIIS EVLDSDLMFN RDAREIIIKS GIEFIMILSS MASEMAESDA        60
     KKTIAPEHVI KALKELEYNE FIPLLEQILI EFKGTQKIKE KKNSKFKKSG LTEEELLQQQ       120
     EELFRKSRSR LHQNSVSGSA TDST                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page