(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE62

CAGLA1_12.PE62       Location/Qualifiers
FT   CDS             complement(171045..173900)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500874"
FT                   /locus_tag="CAGL0M01496g"
FT                   /product="Similar to uniprot|Q04175 Saccharomyces
FT                   cerevisiae YDR395w SXM1"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAG62386.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG059555"
FT                   /db_xref="HOGENOM:HBG396152"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B701B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK34"
FT                   /transl_table=1
FT                   /translation="MLDERAILTCIGHTLISDAKVIKQAEDQLYEYQKQPGFTSFLLNV
FT                   VTDNSIAMNVRLSAAIYMKNKIQRSWNTTKYTEGLTKEEQASVKEQLVQTLIKFSESSH
FT                   LRPHLTESIRGILNADNSWDLTATVKELLTSGKQEYLYPGLLLVFEVAIVHRWDMSDNR
FT                   EVIDNFIIEIFPIVENITSQLVNQTDYRSNELLYLVLKSFKYSCLNNLPKYFADLDKLN
FT                   AWIQLHLFICQKPLPAEVLELDPSDRSLDKRVKVNKWGFGNLTRFLYRYSRSTKVITPE
FT                   FVNYVFTKIVPEIIQEYFKFIESWSNKSLWLGEASLYYMVQFLEKCMITNELFPLLEPH
FT                   LNVVLQHLIFPCLCATEESVELLYEDPEEYTRRYFDLNKDGSMADFASSDFVYMLGTVR
FT                   PDKLNEVLVFINEVFTNFSQHKGDKEWSFKQEGAMRMISTLFSLFQNPQDLEGMFSNYI
FT                   VNFLADDSHHFLVARALETVASYPYDINDMGTLSKLFEQTYGHFLNSDCLPIQVEAADA
FT                   LKSLVVLNPNIHGHISSQVPGIMEKLLKLSKEFEIDILSEVMESFVENFADELTPFAKD
FT                   LAVNLAEQFLNLGRSIVESTNGAYSTGDQDQETQACALLATMTTMVMSMNKVSLVEQFA
FT                   PVVKFVIVHAQISFITEIVDLMDSLALSSKALFNQFTPEIWEMFHDVMDSFQTYALDYF
FT                   ESYLVFFETIVLQGFPQDQTFVEPFLSLLSVKLESEIDYDVEGVMNLLTCFALSMKETP
FT                   FLEKALSRAMDEEFGLDDKQVIKMVLAYLFVKPIETLQVMESSGVTLNILKRWFDLKFK
FT                   SVFAIKLQILAIMSILKLPELPSCVSGYLKEFSNKLVTLVEQLPVAIRNREALNKGEEL
FT                   SGGADGTDLLDPQEEDEYLEEYDDDLKESILDQVNAFQEVSVFLTSLQSENPQRYQDII
FT                   SGMSDDKKESLQVILEFVSNN"
     MLDERAILTC IGHTLISDAK VIKQAEDQLY EYQKQPGFTS FLLNVVTDNS IAMNVRLSAA        60
     IYMKNKIQRS WNTTKYTEGL TKEEQASVKE QLVQTLIKFS ESSHLRPHLT ESIRGILNAD       120
     NSWDLTATVK ELLTSGKQEY LYPGLLLVFE VAIVHRWDMS DNREVIDNFI IEIFPIVENI       180
     TSQLVNQTDY RSNELLYLVL KSFKYSCLNN LPKYFADLDK LNAWIQLHLF ICQKPLPAEV       240
     LELDPSDRSL DKRVKVNKWG FGNLTRFLYR YSRSTKVITP EFVNYVFTKI VPEIIQEYFK       300
     FIESWSNKSL WLGEASLYYM VQFLEKCMIT NELFPLLEPH LNVVLQHLIF PCLCATEESV       360
     ELLYEDPEEY TRRYFDLNKD GSMADFASSD FVYMLGTVRP DKLNEVLVFI NEVFTNFSQH       420
     KGDKEWSFKQ EGAMRMISTL FSLFQNPQDL EGMFSNYIVN FLADDSHHFL VARALETVAS       480
     YPYDINDMGT LSKLFEQTYG HFLNSDCLPI QVEAADALKS LVVLNPNIHG HISSQVPGIM       540
     EKLLKLSKEF EIDILSEVME SFVENFADEL TPFAKDLAVN LAEQFLNLGR SIVESTNGAY       600
     STGDQDQETQ ACALLATMTT MVMSMNKVSL VEQFAPVVKF VIVHAQISFI TEIVDLMDSL       660
     ALSSKALFNQ FTPEIWEMFH DVMDSFQTYA LDYFESYLVF FETIVLQGFP QDQTFVEPFL       720
     SLLSVKLESE IDYDVEGVMN LLTCFALSMK ETPFLEKALS RAMDEEFGLD DKQVIKMVLA       780
     YLFVKPIETL QVMESSGVTL NILKRWFDLK FKSVFAIKLQ ILAIMSILKL PELPSCVSGY       840
     LKEFSNKLVT LVEQLPVAIR NREALNKGEE LSGGADGTDL LDPQEEDEYL EEYDDDLKES       900
     ILDQVNAFQE VSVFLTSLQS ENPQRYQDII SGMSDDKKES LQVILEFVSN N                951
//

If you have problems or comments...

PBIL Back to PBIL home page