(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE63

CAGLA1_12.PE63       Location/Qualifiers
FT   CDS             complement(174378..175595)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436709"
FT                   /gene_name="SHE9"
FT                   /locus_tag="CAGL0M01518g"
FT                   /product="Sensitive to high expression protein 9 homolog,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62387.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG252679"
FT                   /db_xref="InterPro:IPR008839"
FT                   /db_xref="UniParc:UPI00003B701C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK33"
FT                   /transl_table=1
FT                   /translation="MYSYRYLRPVSRSGRAILIQRQAYLRNITFTHFRCEENKSSASKR
FT                   PTGNALNTKLNELNGSLNNLWNKFLEGRGVFQHHAKNIRKSIQEANKKIAEQEKESKDA
FT                   KINYKKDELTNEEIKDLPSERELHRKKWSRKLEFYLDSLQETLFTATKALNDVTGYSSI
FT                   QKLKNSINLINEKLDATRKARTDLKLQYTKAIESRTLSQKQLNELLQRKSSWSPSDLEN
FT                   FTKLYKDDAINQQTEKELKEKVRDIEKKEEQLTDDLYRAILTRYHEEQIWSDKIRRTST
FT                   WGTFILMGFNLVLFIIFQLLLEPWKRRRLTGSFEGKVRHALELHSQEQETKIRDFLEEI
FT                   KTKESNNIANEQKTITKLSFWDKLRNTFQNSTGLSLTQFNMLELTVTAINSFLVGILFT
FT                   LLLHAL"
     MYSYRYLRPV SRSGRAILIQ RQAYLRNITF THFRCEENKS SASKRPTGNA LNTKLNELNG        60
     SLNNLWNKFL EGRGVFQHHA KNIRKSIQEA NKKIAEQEKE SKDAKINYKK DELTNEEIKD       120
     LPSERELHRK KWSRKLEFYL DSLQETLFTA TKALNDVTGY SSIQKLKNSI NLINEKLDAT       180
     RKARTDLKLQ YTKAIESRTL SQKQLNELLQ RKSSWSPSDL ENFTKLYKDD AINQQTEKEL       240
     KEKVRDIEKK EEQLTDDLYR AILTRYHEEQ IWSDKIRRTS TWGTFILMGF NLVLFIIFQL       300
     LLEPWKRRRL TGSFEGKVRH ALELHSQEQE TKIRDFLEEI KTKESNNIAN EQKTITKLSF       360
     WDKLRNTFQN STGLSLTQFN MLELTVTAIN SFLVGILFTL LLHAL                       405
//

If you have problems or comments...

PBIL Back to PBIL home page