(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE66

CAGLA1_12.PE66       Location/Qualifiers
FT   CDS             178971..180869
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436710"
FT                   /locus_tag="CAGL0M01606g"
FT                   /product="Similar to uniprot|P52488 Saccharomyces
FT                   cerevisiae YDR390c UBA2 E1-like"
FT                   /function="ATP binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAG62390.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG326381"
FT                   /db_xref="HOGENOM:HBG517846"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI00003B701F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK30"
FT                   /transl_table=1
FT                   /translation="MAVRESNLVKILGDEGYQKLRSTKCLLVGAGGIGSELLKDLVLME
FT                   VGEIHVVDLDTIDLSNLNRQFLFRQKDIKKPKSAIAVNAVQSFSNSKLVPYQDNIMDTN
FT                   VFPLHWFQQFDIIFNALDNLAARRYVNKMTQFLSIPLLESGTSGFDGYIQPIIPGKTEC
FT                   FDCTKKETPKTFPVCTIRSTPSLPVHCIVWAKNFLFGQLFSSSANDIANEQMNEQDWGT
FT                   DDVEEINRIKNETNELKELQNIIISGDKSRIRDIISKLFIQDIEKLLLIENLWKTRAKP
FT                   VALTPKQLQESEQLGDVNHLNLNEIWDLETQIAKFTQITSKLMDRYNTESAIDFDKDDQ
FT                   DTLEFVATAANIRAHIFHIPVKSVFDIKQIAGNIIPAIATTNAIIAGLSSLMSLRVLNL
FT                   LKYAKVDKPTDINMAFTAKASNLAQNRYLSNPKLVSPNKKCAVCSKVIRGVFKVTKNQM
FT                   EKHSFMDFINALTSTSKLSDDISILDATTQRLLYDYDFEDLAEKKLVDLSLKNGSVLLI
FT                   TDEEEEAGLTKQIMEYYIEISDESEDKIEQLSLPQIIPQFSIPSETADENGGGDMLQND
FT                   SLMTSNDQTTPIVVSESDAVENGNNKRPLTEELEYQSIKSRKLNPIEDDDELVILD"
     MAVRESNLVK ILGDEGYQKL RSTKCLLVGA GGIGSELLKD LVLMEVGEIH VVDLDTIDLS        60
     NLNRQFLFRQ KDIKKPKSAI AVNAVQSFSN SKLVPYQDNI MDTNVFPLHW FQQFDIIFNA       120
     LDNLAARRYV NKMTQFLSIP LLESGTSGFD GYIQPIIPGK TECFDCTKKE TPKTFPVCTI       180
     RSTPSLPVHC IVWAKNFLFG QLFSSSANDI ANEQMNEQDW GTDDVEEINR IKNETNELKE       240
     LQNIIISGDK SRIRDIISKL FIQDIEKLLL IENLWKTRAK PVALTPKQLQ ESEQLGDVNH       300
     LNLNEIWDLE TQIAKFTQIT SKLMDRYNTE SAIDFDKDDQ DTLEFVATAA NIRAHIFHIP       360
     VKSVFDIKQI AGNIIPAIAT TNAIIAGLSS LMSLRVLNLL KYAKVDKPTD INMAFTAKAS       420
     NLAQNRYLSN PKLVSPNKKC AVCSKVIRGV FKVTKNQMEK HSFMDFINAL TSTSKLSDDI       480
     SILDATTQRL LYDYDFEDLA EKKLVDLSLK NGSVLLITDE EEEAGLTKQI MEYYIEISDE       540
     SEDKIEQLSL PQIIPQFSIP SETADENGGG DMLQNDSLMT SNDQTTPIVV SESDAVENGN       600
     NKRPLTEELE YQSIKSRKLN PIEDDDELVI LD                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page