(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE67

CAGLA1_12.PE67       Location/Qualifiers
FT   CDS             complement(181274..183079)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436711"
FT                   /locus_tag="CAGL0M01628g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62391.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="HOGENOM:HBG124178"
FT                   /db_xref="HOGENOM:HBG203279"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI00003B7020"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK29"
FT                   /transl_table=1
FT                   /translation="MPNKHSISPSRHMPFWKNFVNNPKSVSSENLSTPSRPVYQRGHSY
FT                   NHTAPKTGSPIKNEVGAAERQDFRDYRDQFLSGRNGFSGRVFGVSLEESLSVASAEVIV
FT                   QSELVSFGRIPIVVAKCGAYLKSNGLSTSGVFRIAGNSKRIKELQYIFSTPPDYGAKFS
FT                   NWEPYTVHDVASLLRRYLNNLEEPLIPLALYEKFRAPLMNRPRILKYMLNNEVSHPNAN
FT                   KENTLTMKLTESTKQDTDDRANDGDNENEDEQHITEEEAKRKQLRRKKKLSRCIRAAIK
FT                   EYEELFTDLLSDSKQLTIYLLDLLSLFARQSQLNLMSGSNLAAIFQPSILSHPQHDLDP
FT                   KEYELSRLVVEFLIEYTYKLLPHLLKSTKDDQQKKISESVHQKSTTESTTNRDKTSSPL
FT                   PNIQIQTETTTIKGTPDNSKTTSTATSQQNNIHSKPEAKSPALQVPKYQRPHSRSIGSA
FT                   PMVPDVIASNKRRSRLFPWLHKPGILSDTGDTATDGEGDDLLNDDENVDPHLSSPVHSS
FT                   NHRQHLLSIPKVQRSVSGRSITSNSSGRPLSLILNRSEDNLPKNGSSSTEKFERPRSPI
FT                   AYSQESIESKAKKRESWFARLTSRN"
     MPNKHSISPS RHMPFWKNFV NNPKSVSSEN LSTPSRPVYQ RGHSYNHTAP KTGSPIKNEV        60
     GAAERQDFRD YRDQFLSGRN GFSGRVFGVS LEESLSVASA EVIVQSELVS FGRIPIVVAK       120
     CGAYLKSNGL STSGVFRIAG NSKRIKELQY IFSTPPDYGA KFSNWEPYTV HDVASLLRRY       180
     LNNLEEPLIP LALYEKFRAP LMNRPRILKY MLNNEVSHPN ANKENTLTMK LTESTKQDTD       240
     DRANDGDNEN EDEQHITEEE AKRKQLRRKK KLSRCIRAAI KEYEELFTDL LSDSKQLTIY       300
     LLDLLSLFAR QSQLNLMSGS NLAAIFQPSI LSHPQHDLDP KEYELSRLVV EFLIEYTYKL       360
     LPHLLKSTKD DQQKKISESV HQKSTTESTT NRDKTSSPLP NIQIQTETTT IKGTPDNSKT       420
     TSTATSQQNN IHSKPEAKSP ALQVPKYQRP HSRSIGSAPM VPDVIASNKR RSRLFPWLHK       480
     PGILSDTGDT ATDGEGDDLL NDDENVDPHL SSPVHSSNHR QHLLSIPKVQ RSVSGRSITS       540
     NSSGRPLSLI LNRSEDNLPK NGSSSTEKFE RPRSPIAYSQ ESIESKAKKR ESWFARLTSR       600
     N                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page