(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE69

CAGLA1_12.PE69       Location/Qualifiers
FT   CDS             186088..187731
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436712"
FT                   /locus_tag="CAGL0M01672g"
FT                   /product="Similar to uniprot|Q04162 Saccharomyces
FT                   cerevisiae YDR387c"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62393.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B7022"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK27"
FT                   /transl_table=1
FT                   /translation="MVDENSNNENGLDQEEEIDVYSDLYSTYTQVTSLTTNDVDNTTYP
FT                   MTWKTVALFGSSTVGGLLFGYDTGVISGVLLSLKPQDLGRATISDWDKELITSITCLGC
FT                   FVGSLLGSPLADKYGRRITLAIFCVLFIVAALWMALASNLVLLVFGRFVVGIAVGTAAQ
FT                   CTPVYLCEISPAKIRGQILALNSIAVTGGQFLSYIFAYELYDVNGSWRILFGLSAVPAI
FT                   IFLSMLDFIPESPRWLVSMSKYDSAKAALRMIYPTASPGQINLKFNELVINLSKLKHYQ
FT                   DEQTSLMVPLSVRSSRVTINSADYGSVANLRSLHSLMNEPSGTNHSNKTVHHRMEPRTK
FT                   RALLIGCVLMFFQQITGFNAFMYYAPLIFSKLNSHNPLLPAMSIAFTNFLFTFLAVYLV
FT                   DLVGRRSMLLNTIWIMTVGLLLSTIGFQHENVVVLLFAVSIFVAAYASAMGTIPWSSVE
FT                   FLPLNRRSFGASCISCTNWLTNFVITASYLSVMNKIGTEDTMLFFALFSVMAWFFVYFW
FT                   YPEVKGLSLEEIGKVFENGIDVHYVYRNYY"
     MVDENSNNEN GLDQEEEIDV YSDLYSTYTQ VTSLTTNDVD NTTYPMTWKT VALFGSSTVG        60
     GLLFGYDTGV ISGVLLSLKP QDLGRATISD WDKELITSIT CLGCFVGSLL GSPLADKYGR       120
     RITLAIFCVL FIVAALWMAL ASNLVLLVFG RFVVGIAVGT AAQCTPVYLC EISPAKIRGQ       180
     ILALNSIAVT GGQFLSYIFA YELYDVNGSW RILFGLSAVP AIIFLSMLDF IPESPRWLVS       240
     MSKYDSAKAA LRMIYPTASP GQINLKFNEL VINLSKLKHY QDEQTSLMVP LSVRSSRVTI       300
     NSADYGSVAN LRSLHSLMNE PSGTNHSNKT VHHRMEPRTK RALLIGCVLM FFQQITGFNA       360
     FMYYAPLIFS KLNSHNPLLP AMSIAFTNFL FTFLAVYLVD LVGRRSMLLN TIWIMTVGLL       420
     LSTIGFQHEN VVVLLFAVSI FVAAYASAMG TIPWSSVEFL PLNRRSFGAS CISCTNWLTN       480
     FVITASYLSV MNKIGTEDTM LFFALFSVMA WFFVYFWYPE VKGLSLEEIG KVFENGIDVH       540
     YVYRNYY                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page