(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE70

CAGLA1_12.PE70       Location/Qualifiers
FT   CDS             complement(187841..190675)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436713"
FT                   /locus_tag="CAGL0M01694g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="formate-tetrahydrofolate ligase activity "
FT                   /function="methenyltetrahydrofolate cyclohydrolase activity"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NADP+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="CAG62394.1"
FT                   /db_xref="GO:0004329"
FT                   /db_xref="GO:0004477"
FT                   /db_xref="GO:0004488"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG181856"
FT                   /db_xref="HOGENOM:HBG677721"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniParc:UPI00003B7023"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK26"
FT                   /transl_table=1
FT                   /translation="MLKFLRTNRYYHLLSGTKLSQKIIEQCRNEIDTIRKNHKFLPTLK
FT                   ILQVGNRLDSSAYVNMKLKKSEQSGVKCIVEKLPESITEFELLSKIEAINNDTSIHGLL
FT                   IQLPLPKHLDETTITSSVSVDKDVDGFHIYNAGELTKKNGHPKFIPCTPNGCIELLKEH
FT                   NITIAGKNAVVIGRSSIVGTPITSLLKNLDATVTQCHSKTVNLPEIVKTADIVIAACGQ
FT                   ANMIKGEWLKEGAVVIDVGINHVPDNTKKSGHRLVGDVDFDSASKKASYITPVPGGVGQ
FT                   MTVAMLVSNVVLAAKRSLANFEKVPEIKPLPLKLEKPVPSDFEISKSQEPKHIDNLAKE
FT                   LGIFQDELELHGHYKGKISTSILDRLESKKNGRYVLVAGITPTPLGEGKSTTTMGLVQA
FT                   LTGHLGKPSIANVRQPSMGPTFGVKGGAAGGGYAQVIPMDQFNLHLTGDIHAVGVANNL
FT                   LAAAIDTRMLHESTIKNDAKFYDKLVPKKNGIRSFSPAMTRRLERLGINKTNPDELTAE
FT                   EINKFVRLNINPDTINIKRVVDVNDRMLRKITIGQAATEKGRTRETGFDITVASELMAI
FT                   LALSTSLQDMKRRVSKLVVASDINGKPVTVDDIGCSGAIVALMTDTIKPNLMQTLEGSP
FT                   VLVHAGPFANISIGASSVMADKIALKLMGTCLDSQEPGYVVTEAGFDFSMGGERFFNIK
FT                   CRSSGLVPDTVVLVATVRAIKSHGGAPDVKPGQALPQEYIEENIEFVKKGVANLVKQIE
FT                   NVKKFGVPVVVAINKFSTDTENETKAIEESCKAAGANNVVVSNHWEEGGKGAIDLANAV
FT                   VQSCEEPKSFQFLYDTDLPIKEKLETIVKEMYGGAGIELSEKAQKQIALYTEQGFDKLP
FT                   ICIAKTQYSLSHDPKLKGVPQDFIVPIRDIRASIGAGYLYALAAEIQTIPGLSVHAGYL
FT                   NVEVDDKGNINGLF"
     MLKFLRTNRY YHLLSGTKLS QKIIEQCRNE IDTIRKNHKF LPTLKILQVG NRLDSSAYVN        60
     MKLKKSEQSG VKCIVEKLPE SITEFELLSK IEAINNDTSI HGLLIQLPLP KHLDETTITS       120
     SVSVDKDVDG FHIYNAGELT KKNGHPKFIP CTPNGCIELL KEHNITIAGK NAVVIGRSSI       180
     VGTPITSLLK NLDATVTQCH SKTVNLPEIV KTADIVIAAC GQANMIKGEW LKEGAVVIDV       240
     GINHVPDNTK KSGHRLVGDV DFDSASKKAS YITPVPGGVG QMTVAMLVSN VVLAAKRSLA       300
     NFEKVPEIKP LPLKLEKPVP SDFEISKSQE PKHIDNLAKE LGIFQDELEL HGHYKGKIST       360
     SILDRLESKK NGRYVLVAGI TPTPLGEGKS TTTMGLVQAL TGHLGKPSIA NVRQPSMGPT       420
     FGVKGGAAGG GYAQVIPMDQ FNLHLTGDIH AVGVANNLLA AAIDTRMLHE STIKNDAKFY       480
     DKLVPKKNGI RSFSPAMTRR LERLGINKTN PDELTAEEIN KFVRLNINPD TINIKRVVDV       540
     NDRMLRKITI GQAATEKGRT RETGFDITVA SELMAILALS TSLQDMKRRV SKLVVASDIN       600
     GKPVTVDDIG CSGAIVALMT DTIKPNLMQT LEGSPVLVHA GPFANISIGA SSVMADKIAL       660
     KLMGTCLDSQ EPGYVVTEAG FDFSMGGERF FNIKCRSSGL VPDTVVLVAT VRAIKSHGGA       720
     PDVKPGQALP QEYIEENIEF VKKGVANLVK QIENVKKFGV PVVVAINKFS TDTENETKAI       780
     EESCKAAGAN NVVVSNHWEE GGKGAIDLAN AVVQSCEEPK SFQFLYDTDL PIKEKLETIV       840
     KEMYGGAGIE LSEKAQKQIA LYTEQGFDKL PICIAKTQYS LSHDPKLKGV PQDFIVPIRD       900
     IRASIGAGYL YALAAEIQTI PGLSVHAGYL NVEVDDKGNI NGLF                        944
//

If you have problems or comments...

PBIL Back to PBIL home page