(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE73

CAGLA1_12.PE73       Location/Qualifiers
FT   CDS             203616..208115
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348725"
FT                   /locus_tag="CAGL0M01760g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62397.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI00003B7026"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK23"
FT                   /transl_table=1
FT                   /translation="MSLASDKKDADVASTTTTAQDDDNLSTYHGFDHHVQDQVRQLART
FT                   LTQQSSLHQKKEHTLPEEGINPIFTNTEADDYNPRLDPTSDEFSSAEWVQNMSNISNSD
FT                   PDYYKPYSLGCYWKDLVATGESADIEYQANFLNGPYKGLKTVYNTVVPSTASSKDKNFK
FT                   ILKSMEGAVNPGELLVVLGRPGSGCTTLLKSISSNTHGFNIAKESTISYSGMTPNDIRK
FT                   HFRGEVVYNAEADIHLPHLTVYQTLLTVARLKTPQNRLKGIDRETYARHLTEVAMATFG
FT                   LSHTRNTKVGNDLVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIRAL
FT                   KVQASISNAAATVAIYQCSQDAYDLFDKVCVLYDGYQIYFGPAGKAKEYFQKMGYVSPE
FT                   RQTTADFLTAVTSPSERIINQDYINRGIFVPQTPKEMWEYWRASEDHADLIKEIDSKLS
FT                   DNYDANLAEIKDAHVARQSKRARPSSPYTVSYGMQIKYLLIRNFWRIKQSSGVTLFMVI
FT                   GNSSMAFILGSMFYKVMKHNTTSTFYFRGAAMFFAVLFNAFSSLLEIFSLFEARPITEK
FT                   HRTYSLYHPSADAFASILSEVPAKLITAVCFNIIYYFLVNFRRNGGVFFFYFLINIVAV
FT                   FAMSHLFRCVGSVSKTLSAAMVPASMLLLGLSMYSGFAIPRTKILGWSKWIWYINPLAY
FT                   LFESLMINEFHDRKFPCSQYIPSGSVYNNVPADSRICSSVGAIRGNDYVLGDDFLRESY
FT                   SYLHKHKWRGFGIGLAYVIFFLVLYLILCEYNEGAKQKGEILVFPQNIVRRMKKERKLK
FT                   NVSSDNDVEIGDVSDISDKKILADSSDESEESGANIGLSQSEAIFHWRNLCYDVQIKKE
FT                   TRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQRDDSF
FT                   ARSIGYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEKNQYVEDVIKILEMEQYADA
FT                   VVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHG
FT                   QAILCTIHQPSAILMQEFDRLLFLQRGGKTVYFGDLGDGCKTMIDYFESHGSHKCPPDA
FT                   NPAEWMLEVVGAAPGSHANQDYHEVWRNSDEYQKVQEELEWMSNELPKKNTNNSETVHK
FT                   EFATGVLYQCKLVSLRLFQQYWRSPDYLWSKFFLTIFNNIFIGFTFFKADRSLQGLQNQ
FT                   MLAVFMFTVIFNPLLQQYLPSFVQQRDLYEARERPSRTFSWKAFIVSQILVEIPWNILA
FT                   GTVAFVIYYYAIGFYSNASVAHQLHERGALFWLFSCAFYVYIGSLALFCISFNQVAEAA
FT                   ANMASLMFTLSLSFCGVLVTPNGMPRFWIFMYRVSPLTYLIDGMLSTGVANVAIKCSNY
FT                   ELLRFSPAANLTCGEYLGPYLQTVKTGYIVDPSATDTCELCPYSHTNDFLSSVSSKYSR
FT                   RWRNWGIFICYIAFNYIAGIFLYWLARVPKKSGKLAKK"
     MSLASDKKDA DVASTTTTAQ DDDNLSTYHG FDHHVQDQVR QLARTLTQQS SLHQKKEHTL        60
     PEEGINPIFT NTEADDYNPR LDPTSDEFSS AEWVQNMSNI SNSDPDYYKP YSLGCYWKDL       120
     VATGESADIE YQANFLNGPY KGLKTVYNTV VPSTASSKDK NFKILKSMEG AVNPGELLVV       180
     LGRPGSGCTT LLKSISSNTH GFNIAKESTI SYSGMTPNDI RKHFRGEVVY NAEADIHLPH       240
     LTVYQTLLTV ARLKTPQNRL KGIDRETYAR HLTEVAMATF GLSHTRNTKV GNDLVRGVSG       300
     GERKRVSIAE VSICGSKFQC WDNATRGLDS ATALEFIRAL KVQASISNAA ATVAIYQCSQ       360
     DAYDLFDKVC VLYDGYQIYF GPAGKAKEYF QKMGYVSPER QTTADFLTAV TSPSERIINQ       420
     DYINRGIFVP QTPKEMWEYW RASEDHADLI KEIDSKLSDN YDANLAEIKD AHVARQSKRA       480
     RPSSPYTVSY GMQIKYLLIR NFWRIKQSSG VTLFMVIGNS SMAFILGSMF YKVMKHNTTS       540
     TFYFRGAAMF FAVLFNAFSS LLEIFSLFEA RPITEKHRTY SLYHPSADAF ASILSEVPAK       600
     LITAVCFNII YYFLVNFRRN GGVFFFYFLI NIVAVFAMSH LFRCVGSVSK TLSAAMVPAS       660
     MLLLGLSMYS GFAIPRTKIL GWSKWIWYIN PLAYLFESLM INEFHDRKFP CSQYIPSGSV       720
     YNNVPADSRI CSSVGAIRGN DYVLGDDFLR ESYSYLHKHK WRGFGIGLAY VIFFLVLYLI       780
     LCEYNEGAKQ KGEILVFPQN IVRRMKKERK LKNVSSDNDV EIGDVSDISD KKILADSSDE       840
     SEESGANIGL SQSEAIFHWR NLCYDVQIKK ETRRILNNVD GWVKPGTLTA LMGASGAGKT       900
     TLLDCLAERV TMGVITGEVS VDGKQRDDSF ARSIGYCQQQ DLHLKTSTVR ESLRFSAYLR       960
     QPADVSIEEK NQYVEDVIKI LEMEQYADAV VGVPGEGLNV EQRKRLTIGV ELAAKPKLLV      1020
     FLDEPTSGLD SQTAWSICQL MKKLANHGQA ILCTIHQPSA ILMQEFDRLL FLQRGGKTVY      1080
     FGDLGDGCKT MIDYFESHGS HKCPPDANPA EWMLEVVGAA PGSHANQDYH EVWRNSDEYQ      1140
     KVQEELEWMS NELPKKNTNN SETVHKEFAT GVLYQCKLVS LRLFQQYWRS PDYLWSKFFL      1200
     TIFNNIFIGF TFFKADRSLQ GLQNQMLAVF MFTVIFNPLL QQYLPSFVQQ RDLYEARERP      1260
     SRTFSWKAFI VSQILVEIPW NILAGTVAFV IYYYAIGFYS NASVAHQLHE RGALFWLFSC      1320
     AFYVYIGSLA LFCISFNQVA EAAANMASLM FTLSLSFCGV LVTPNGMPRF WIFMYRVSPL      1380
     TYLIDGMLST GVANVAIKCS NYELLRFSPA ANLTCGEYLG PYLQTVKTGY IVDPSATDTC      1440
     ELCPYSHTND FLSSVSSKYS RRWRNWGIFI CYIAFNYIAG IFLYWLARVP KKSGKLAKK       1499
//

If you have problems or comments...

PBIL Back to PBIL home page