(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE75

CAGLA1_12.PE75       Location/Qualifiers
FT   CDS             211439..214294
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044346"
FT                   /gene_name="TIF32"
FT                   /locus_tag="CAGL0M01804g"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit A"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62399.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG028011"
FT                   /db_xref="HOGENOM:HBG382149"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI00003B7028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK21"
FT                   /transl_table=1
FT                   /translation="MAPPPLRPENALKRADELISVNEKPAALQSLYEFITARRIRYATP
FT                   SQVEPIVFKFLELGVELKKGKLIKDALYQYKKLVHGSAEGLVSVGAVLRKFIDYVETKL
FT                   ASEQAKAEEKQKEEVSDDLEGGVTPENLLSSVYEADHSVAGFNDEALNSWMRFSWESYR
FT                   TALDLLRNNSQLEITYSGVVSRTMQFCLKHQRKNEFKRLAEMLRQHLDTANYHQSKFGS
FT                   NQVDLSDADTLQRYLDQRFQLVDASVKLGLWHEAYKAAEDVYHLMKMTTRKPKSSTLAN
FT                   YFENLVQIFLVSGDQILHTLAWKKYFELYSTNPNATEEEFKKIASTIFLSALSIQLDDL
FT                   PNVRYNYQSRSYRLLDVETKPTRKEVIQSIVEDDTIFSRVDAETKTLYEIMEVEFDGES
FT                   FKGKFEAILPKLEGESYFANYSVSLRDVIIRRMFVFASQKYEDISLNDLYSSVTFSSSF
FT                   KLSEWDIEKQLLQAAVDDYVSFQLDHEQNKVTFVKDPLVNFAAIKEEEVEEEEEEEEEE
FT                   EEEEKEAEGAEGAEGDTEEGQEAVAEPEPVIKRNYYIRKRLSELYEKLLEDTDYNTVSY
FT                   LDKVRIAREALIKHTKDTIEDMKKNSEERAKMHQERRRQHMESAAMNAEKDAEQRQKRI
FT                   MEERASIEAKLEEEAHRRLIEKKKREFEEVKQREIRKLVDELNAKGNGTKVEYDEVKDM
FT                   DIPDITKYFVNRLSKNKDELEERMNFAVKRMDHLERAYRKVELPLLKKQADELRATDEV
FT                   NFGNMKKKIVDAAKAEYEAKMEDYNRVSSVFDDYKTLRDRMLAAHNEKFAAIRAENAAK
FT                   LEAAKKARIEEVRKQRYEELLARSEAEKKAAEEAERRAKLDEIARKQREMEEALERKSA
FT                   ARTFTQPRAPVVPNANLDEIARKQREMEEAIERKLAGKSAAPAPAPAPAASTPAASTPA
FT                   APGKMSFAERMRLKRQQQQQK"
     MAPPPLRPEN ALKRADELIS VNEKPAALQS LYEFITARRI RYATPSQVEP IVFKFLELGV        60
     ELKKGKLIKD ALYQYKKLVH GSAEGLVSVG AVLRKFIDYV ETKLASEQAK AEEKQKEEVS       120
     DDLEGGVTPE NLLSSVYEAD HSVAGFNDEA LNSWMRFSWE SYRTALDLLR NNSQLEITYS       180
     GVVSRTMQFC LKHQRKNEFK RLAEMLRQHL DTANYHQSKF GSNQVDLSDA DTLQRYLDQR       240
     FQLVDASVKL GLWHEAYKAA EDVYHLMKMT TRKPKSSTLA NYFENLVQIF LVSGDQILHT       300
     LAWKKYFELY STNPNATEEE FKKIASTIFL SALSIQLDDL PNVRYNYQSR SYRLLDVETK       360
     PTRKEVIQSI VEDDTIFSRV DAETKTLYEI MEVEFDGESF KGKFEAILPK LEGESYFANY       420
     SVSLRDVIIR RMFVFASQKY EDISLNDLYS SVTFSSSFKL SEWDIEKQLL QAAVDDYVSF       480
     QLDHEQNKVT FVKDPLVNFA AIKEEEVEEE EEEEEEEEEE EKEAEGAEGA EGDTEEGQEA       540
     VAEPEPVIKR NYYIRKRLSE LYEKLLEDTD YNTVSYLDKV RIAREALIKH TKDTIEDMKK       600
     NSEERAKMHQ ERRRQHMESA AMNAEKDAEQ RQKRIMEERA SIEAKLEEEA HRRLIEKKKR       660
     EFEEVKQREI RKLVDELNAK GNGTKVEYDE VKDMDIPDIT KYFVNRLSKN KDELEERMNF       720
     AVKRMDHLER AYRKVELPLL KKQADELRAT DEVNFGNMKK KIVDAAKAEY EAKMEDYNRV       780
     SSVFDDYKTL RDRMLAAHNE KFAAIRAENA AKLEAAKKAR IEEVRKQRYE ELLARSEAEK       840
     KAAEEAERRA KLDEIARKQR EMEEALERKS AARTFTQPRA PVVPNANLDE IARKQREMEE       900
     AIERKLAGKS AAPAPAPAPA ASTPAASTPA APGKMSFAER MRLKRQQQQQ K                951
//

If you have problems or comments...

PBIL Back to PBIL home page