(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE76

CAGLA1_12.PE76       Location/Qualifiers
FT   CDS             complement(215340..216605)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500877"
FT                   /locus_tag="CAGL0M01826g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62400.1"
FT                   /db_xref="HOGENOM:HBG398340"
FT                   /db_xref="HOGENOM:HBG429547"
FT                   /db_xref="UniParc:UPI00003B7029"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK20"
FT                   /transl_table=1
FT                   /translation="MKVTSLVYAAMATSVLGQNSTSDDVPSGCSLGSSATATAQSDLDK
FT                   YSGCETIVGNLTITGALGSAALAGVKKIDGSLRIYNATSLGSFAADSVKEITGALNMQD
FT                   LTILTTASFGALEEVDTINLITLPAISTFNTNLQSANNIVVSDTSLESVEGFGSLKEVN
FT                   VLNINNNRYLNSFKSSLESVSGALQFASNADETAVSFDNLIWANNITLRDVQNASFAKL
FT                   ESVNASLGFINNTISTLNLTHLSKVGQSLSVVSNDDLTQLSFLNLTSVGGGLVVANNTN
FT                   LKTIDGLKNVQTVGGAIDITGNFTTLDLSSLKSVRGGATFNTVSGNFSCSPLKSLQSKG
FT                   AIQGDSFVCKNGATSTSISMSSRSRSSSASSSASATVTARSNDTASTSSTKTKKSKGAA
FT                   AQEVFPAGSFFGAVAAVAVALL"
     MKVTSLVYAA MATSVLGQNS TSDDVPSGCS LGSSATATAQ SDLDKYSGCE TIVGNLTITG        60
     ALGSAALAGV KKIDGSLRIY NATSLGSFAA DSVKEITGAL NMQDLTILTT ASFGALEEVD       120
     TINLITLPAI STFNTNLQSA NNIVVSDTSL ESVEGFGSLK EVNVLNINNN RYLNSFKSSL       180
     ESVSGALQFA SNADETAVSF DNLIWANNIT LRDVQNASFA KLESVNASLG FINNTISTLN       240
     LTHLSKVGQS LSVVSNDDLT QLSFLNLTSV GGGLVVANNT NLKTIDGLKN VQTVGGAIDI       300
     TGNFTTLDLS SLKSVRGGAT FNTVSGNFSC SPLKSLQSKG AIQGDSFVCK NGATSTSISM       360
     SSRSRSSSAS SSASATVTAR SNDTASTSST KTKKSKGAAA QEVFPAGSFF GAVAAVAVAL       420
     L                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page