(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE78

CAGLA1_12.PE78       Location/Qualifiers
FT   CDS             complement(219813..220760)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044347"
FT                   /locus_tag="CAGL0M01870g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62402.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124181"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B702B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK18"
FT                   /transl_table=1
FT                   /translation="MIFESNPLNSFMLDDEERFKIDDYLDCFNDMSLPAIQNTTVIQPF
FT                   SMYNESYEKLFNETDSIISDEPSSVFELDTNSRRDTLKSEGFISLEHPDMLQKRDSDSQ
FT                   YHFKNELPYPRDEVVKMAEAYPPSLQKVEESVSPKSSCIQPADDETSNAFDEKFSAQAE
FT                   INKTSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHY
FT                   KLHFKLSNGAYILPTGEICAEKPTAKQLLQSSKRTSSRVQKKRKTSNTTTSTYVSDGYP
FT                   SEVDVSGSATPLNNDVLCKPYLNVLHQGGEASSI"
     MIFESNPLNS FMLDDEERFK IDDYLDCFND MSLPAIQNTT VIQPFSMYNE SYEKLFNETD        60
     SIISDEPSSV FELDTNSRRD TLKSEGFISL EHPDMLQKRD SDSQYHFKNE LPYPRDEVVK       120
     MAEAYPPSLQ KVEESVSPKS SCIQPADDET SNAFDEKFSA QAEINKTSED TKFICKVCLK       180
     KFKRPSSLST HMNIHTGEKP YPCPFDNCTK SFNAKSNMLR HYKLHFKLSN GAYILPTGEI       240
     CAEKPTAKQL LQSSKRTSSR VQKKRKTSNT TTSTYVSDGY PSEVDVSGSA TPLNNDVLCK       300
     PYLNVLHQGG EASSI                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page