(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE80

CAGLA1_12.PE80       Location/Qualifiers
FT   CDS             232780..234810
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500878"
FT                   /locus_tag="CAGL0M01914g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG62404.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG124184"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B702D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK16"
FT                   /transl_table=1
FT                   /translation="MSEEFSSWYGDVTRKCGSLAIDLGLSTLAFDQLVKLLEQEKHIST
FT                   ILLLVRLYLKNKDYYNVVTFLVNGRDNEILSDYRVWKAIALSYFKLNNVQDSLNAVDYA
FT                   LKLKSDDQDTLLLKARIMSFLDDSSLKTQYEALISSYSDKSSKEYYQILVCYMQYSRNI
FT                   GDIPKCFEIFQAISQEFSRTQKKRSINFLQVFSYAYQLYASTIYLTEGNINEAGRKRKR
FT                   GYNNDSPLEVINEFLSISERNYNSSLSIQPLKILQGQISFIEGIDLRESINYLNLELQI
FT                   LNNHAATLSEEGVYHKSILNYMIARNMLKLNPHENAQVAYEYFQNSLSLTPNLPFIWIS
FT                   VASLYLTLGQLEDSLATYSQAISLAMSFENVLPPKELSYYKRFAAVAWHGISQVYTVTL
FT                   QLTNAIEALDHAISIVYQEHDVTTEQELTSLRNEYVKLNSQSTPHPNIVYSLPEVSMKL
FT                   LLEYETCRDSFLFQNIDDLEIIDKNNLNDGAIKNFAGQVTTLTTQPPTDQSTLRVLNTA
FT                   NGTNSIAYTQKPPGSEVYTRKQSVTGTPSSAHAQQYGRNPQLSSSMSQTLNAPIQDVRT
FT                   IQQPNGQNIVVGNQILQQQQQQQYTTKQPFVVFNHATQKQELVTPQIVSTENGRYQPQH
FT                   VSMIQGLPQPNPNAYYQVNDGNVVLKPIQSMNNNEFITKVL"
     MSEEFSSWYG DVTRKCGSLA IDLGLSTLAF DQLVKLLEQE KHISTILLLV RLYLKNKDYY        60
     NVVTFLVNGR DNEILSDYRV WKAIALSYFK LNNVQDSLNA VDYALKLKSD DQDTLLLKAR       120
     IMSFLDDSSL KTQYEALISS YSDKSSKEYY QILVCYMQYS RNIGDIPKCF EIFQAISQEF       180
     SRTQKKRSIN FLQVFSYAYQ LYASTIYLTE GNINEAGRKR KRGYNNDSPL EVINEFLSIS       240
     ERNYNSSLSI QPLKILQGQI SFIEGIDLRE SINYLNLELQ ILNNHAATLS EEGVYHKSIL       300
     NYMIARNMLK LNPHENAQVA YEYFQNSLSL TPNLPFIWIS VASLYLTLGQ LEDSLATYSQ       360
     AISLAMSFEN VLPPKELSYY KRFAAVAWHG ISQVYTVTLQ LTNAIEALDH AISIVYQEHD       420
     VTTEQELTSL RNEYVKLNSQ STPHPNIVYS LPEVSMKLLL EYETCRDSFL FQNIDDLEII       480
     DKNNLNDGAI KNFAGQVTTL TTQPPTDQST LRVLNTANGT NSIAYTQKPP GSEVYTRKQS       540
     VTGTPSSAHA QQYGRNPQLS SSMSQTLNAP IQDVRTIQQP NGQNIVVGNQ ILQQQQQQQY       600
     TTKQPFVVFN HATQKQELVT PQIVSTENGR YQPQHVSMIQ GLPQPNPNAY YQVNDGNVVL       660
     KPIQSMNNNE FITKVL                                                       676
//

If you have problems or comments...

PBIL Back to PBIL home page