(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE83

CAGLA1_12.PE83       Location/Qualifiers
FT   CDS             241386..243596
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436718"
FT                   /locus_tag="CAGL0M01980g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="CAG62407.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG124185"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B7030"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK13"
FT                   /transl_table=1
FT                   /translation="MIHVLPKETWQVLRADTQITGIDSVLRELLQNAVDAGASTVDVSF
FT                   SIKKNMCMVADDGCGMTRKDLDLLGRPHITSKIRNFRDLERFGNGNGTMGFRGEAIFAI
FT                   SQISELTMMTKHSDFRAHYWRDFPMTSVLTTEEDIRSSLHAQYLSTTPFYEDIWARSSG
FT                   TVVIVSDLFKYIPVRKKTLENVPVATITDSIREDFYQILVRNPNLKLNIFTFDDNYKNF
FT                   EFLNHVKEQYLHSLGSIPIHNAFIRVYGHVVPDPSIKIVKLSFREYNITGLISNCQVRS
FT                   KSFQFVFVNGRRYSNSEFLGKINRIFDQSTFATNAVEKDTRLGKRSARSYPLFVIKIDG
FT                   PAHVQDLIQSTSKDIIHLSDGKLINILILKVIYSFLKDQGFLTEIPTQLNDDNCDRIDQ
FT                   LGTLEEPIFMDNDFHRDFVIRNNVKMAKYNKVSHANISHPWKRQRLDYPVRRTSKWWKE
FT                   RSVNELHQSRISTKFAPIKKWAAYEKLHVFDYKDRFLSRSDDLKEVDVVNQVDQKFILL
FT                   RQKSARGNFELYIIDQHACDERIRLESFLKQYICDIMANALAVQKIFQSRIEIAISEKE
FT                   NFEQYRHEFSKWGIYYNVVHSNNNYSLDIFALPDMLADKIKANEELKDMMLQHIFDLKD
FT                   GSRSRIKTISSLDAQFLSGGWWSNVNKIPSFIRRFFDSKACRSAIMFGDTLNLQECRDL
FT                   VRRLNGCIQPNFCAHGRPSVVELIGHQHQWELKNFTADYDYD"
     MIHVLPKETW QVLRADTQIT GIDSVLRELL QNAVDAGAST VDVSFSIKKN MCMVADDGCG        60
     MTRKDLDLLG RPHITSKIRN FRDLERFGNG NGTMGFRGEA IFAISQISEL TMMTKHSDFR       120
     AHYWRDFPMT SVLTTEEDIR SSLHAQYLST TPFYEDIWAR SSGTVVIVSD LFKYIPVRKK       180
     TLENVPVATI TDSIREDFYQ ILVRNPNLKL NIFTFDDNYK NFEFLNHVKE QYLHSLGSIP       240
     IHNAFIRVYG HVVPDPSIKI VKLSFREYNI TGLISNCQVR SKSFQFVFVN GRRYSNSEFL       300
     GKINRIFDQS TFATNAVEKD TRLGKRSARS YPLFVIKIDG PAHVQDLIQS TSKDIIHLSD       360
     GKLINILILK VIYSFLKDQG FLTEIPTQLN DDNCDRIDQL GTLEEPIFMD NDFHRDFVIR       420
     NNVKMAKYNK VSHANISHPW KRQRLDYPVR RTSKWWKERS VNELHQSRIS TKFAPIKKWA       480
     AYEKLHVFDY KDRFLSRSDD LKEVDVVNQV DQKFILLRQK SARGNFELYI IDQHACDERI       540
     RLESFLKQYI CDIMANALAV QKIFQSRIEI AISEKENFEQ YRHEFSKWGI YYNVVHSNNN       600
     YSLDIFALPD MLADKIKANE ELKDMMLQHI FDLKDGSRSR IKTISSLDAQ FLSGGWWSNV       660
     NKIPSFIRRF FDSKACRSAI MFGDTLNLQE CRDLVRRLNG CIQPNFCAHG RPSVVELIGH       720
     QHQWELKNFT ADYDYD                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page