(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE85

CAGLA1_12.PE85       Location/Qualifiers
FT   CDS             complement(244928..245581)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034148" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500879"
FT                   /gene_name="ATG29"
FT                   /locus_tag="CAGL0M02013g"
FT                   /product="Autophagy-related protein 29 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="pre-autophagosomal structure "
FT                   /protein_id="CAG62409.1"
FT                   /db_xref="GO:0000407"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG203867"
FT                   /db_xref="HOGENOM:HBG252710"
FT                   /db_xref="UniParc:UPI00003B7032"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK11"
FT                   /transl_table=1
FT                   /translation="MNSKNTIVYVKVKGKRPDGFVDPPVFEWNIQKEKKLWSLLSQLND
FT                   PDKEIDWALLAEGLDAPIYFLKRRCYELFTKHFELLRQQIDRKNKNALTDRSETPERDS
FT                   TEEITKEVNFLNQLPVRTPGTIQEEFNEDNGPKDKNKTPDTTKKAIEQLKSSRILNFKG
FT                   NKLDYNNREVGLTRYDSTYEKEGVHTEETESELSSSLGVSKSTLEEALMDKLQI"
     MNSKNTIVYV KVKGKRPDGF VDPPVFEWNI QKEKKLWSLL SQLNDPDKEI DWALLAEGLD        60
     APIYFLKRRC YELFTKHFEL LRQQIDRKNK NALTDRSETP ERDSTEEITK EVNFLNQLPV       120
     RTPGTIQEEF NEDNGPKDKN KTPDTTKKAI EQLKSSRILN FKGNKLDYNN REVGLTRYDS       180
     TYEKEGVHTE ETESELSSSL GVSKSTLEEA LMDKLQI                                217
//

If you have problems or comments...

PBIL Back to PBIL home page