(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE88

CAGLA1_12.PE88       Location/Qualifiers
FT   CDS             complement(251658..253472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436720"
FT                   /locus_tag="CAGL0M02079g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62412.1"
FT                   /db_xref="HOGENOM:HBG124186"
FT                   /db_xref="UniParc:UPI00003B7035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK08"
FT                   /transl_table=1
FT                   /translation="MDYETLLFELKPLLDIEQLKVANIDESNVQVYTSALEKCSQGARI
FT                   ESNRTIIGRSGLLDSLTESLAFLLEQEFTVDTQSNKNILLIISEIVRVLANSFADNDDN
FT                   RNIFFDKNRFLANPIIETYFAKVLALNLQQNDPDVIITLQMRLAAMVKNLIVDNRNYVT
FT                   HYAAFLCPTSYLRLDSINLTSENEVQMALFIAELIDAILEFDKKGATLDEMKIVSTLYY
FT                   QLSTYITSASVEIDDGDDEEPLIELLATLTNIAEIVFSIDGTFNFDKQQETKDIIQKNI
FT                   LQTIDNLEELKFHNKLIIMRRLVTTSGYIASDKSNTTHSEMNMCLNHLRNENPSPYTIG
FT                   AIFINITNAIRSTEESKELEQTLSIPDIICYSKKLSDPVQFQGVLDLLKKVLNLSNTLL
FT                   LPNDSLQGIANLLTYSNEQAQYFQGLIPLVNGLLNKLLTVIPSSKIEFIFQGNISEGFV
FT                   KLICKNGSISASLALDKLLLVKNPIKKDITDRLWECLFHFDQVAKENNTSESANVYLLF
FT                   QVAKTLGVYLRNTIDKPTEIQDFLLYQYEDQLVFLLSQILDLRDKNVRGSESAMNNGKF
FT                   VAGLIIDAKKSVRTTDDDRLLAICKQFF"
     MDYETLLFEL KPLLDIEQLK VANIDESNVQ VYTSALEKCS QGARIESNRT IIGRSGLLDS        60
     LTESLAFLLE QEFTVDTQSN KNILLIISEI VRVLANSFAD NDDNRNIFFD KNRFLANPII       120
     ETYFAKVLAL NLQQNDPDVI ITLQMRLAAM VKNLIVDNRN YVTHYAAFLC PTSYLRLDSI       180
     NLTSENEVQM ALFIAELIDA ILEFDKKGAT LDEMKIVSTL YYQLSTYITS ASVEIDDGDD       240
     EEPLIELLAT LTNIAEIVFS IDGTFNFDKQ QETKDIIQKN ILQTIDNLEE LKFHNKLIIM       300
     RRLVTTSGYI ASDKSNTTHS EMNMCLNHLR NENPSPYTIG AIFINITNAI RSTEESKELE       360
     QTLSIPDIIC YSKKLSDPVQ FQGVLDLLKK VLNLSNTLLL PNDSLQGIAN LLTYSNEQAQ       420
     YFQGLIPLVN GLLNKLLTVI PSSKIEFIFQ GNISEGFVKL ICKNGSISAS LALDKLLLVK       480
     NPIKKDITDR LWECLFHFDQ VAKENNTSES ANVYLLFQVA KTLGVYLRNT IDKPTEIQDF       540
     LLYQYEDQLV FLLSQILDLR DKNVRGSESA MNNGKFVAGL IIDAKKSVRT TDDDRLLAIC       600
     KQFF                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page