(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE89

CAGLA1_12.PE89       Location/Qualifiers
FT   CDS             complement(254024..254827)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436721"
FT                   /gene_name="PET20"
FT                   /locus_tag="CAGL0M02101g"
FT                   /product="Protein PET20, mitochondrial "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62413.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG124187"
FT                   /db_xref="InterPro:IPR014804"
FT                   /db_xref="UniParc:UPI00003B7036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK07"
FT                   /transl_table=1
FT                   /translation="MSVSLVLCTWGGAARTARVYRVVKQAMIRTMFVRLRSAGQVRYQS
FT                   SFSFPSSQSLLQKGQLGKKKRSVRKLGLGISDKKQYNSGVTSAAQEAGGAVRDLKSEKA
FT                   QTKKKVYDYSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVEPKNSQEGKTLYEFAMK
FT                   LEEFQEAMSPWVSSATGSEMYAEWDNVPGDVIKDLKPFTPPVVNSRKLNGATGENANDF
FT                   DEQGNFQKKAFFDKVQSILNRNGKGGRKRPGVTVLKHLKKLKEQN"
     MSVSLVLCTW GGAARTARVY RVVKQAMIRT MFVRLRSAGQ VRYQSSFSFP SSQSLLQKGQ        60
     LGKKKRSVRK LGLGISDKKQ YNSGVTSAAQ EAGGAVRDLK SEKAQTKKKV YDYSTLPRVE       120
     QISDTKLKNM STEVLYSGYR PLFFDVEPKN SQEGKTLYEF AMKLEEFQEA MSPWVSSATG       180
     SEMYAEWDNV PGDVIKDLKP FTPPVVNSRK LNGATGENAN DFDEQGNFQK KAFFDKVQSI       240
     LNRNGKGGRK RPGVTVLKHL KKLKEQN                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page