(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE93

CAGLA1_12.PE93       Location/Qualifiers
FT   CDS             complement(261290..263308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000988" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195509"
FT                   /locus_tag="CAGL0M02189g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="CAG62417.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG396482"
FT                   /db_xref="HOGENOM:HBG525807"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI00003B703A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK03"
FT                   /transl_table=1
FT                   /translation="MSASRDSEKYRFETPRVMKSPSPSLDSAVSISSYARSRSSVTRGF
FT                   RNGSSSGSSSRSSSPLRPGSFGGDPYLQYGKIRNRSESSSYENGSGNLDKYTGTIKVVI
FT                   RPKPYPTEKIVSWKIHGDKVISHNDIGDFTFDHVFSTGCSNFDIYGKTTQPLIDRLIEG
FT                   YNATIFAYGMTGSGKTFTMSGTEEEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLE
FT                   IYNEKINDLLDVASGSNVQNTPSRLFTSTHTSSSGDLKIRDDSECGVRVVGLTQKRCDT
FT                   SEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGEQNIRTLSLCDLAG
FT                   SERGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRAANSQQSLASPNGSSS
FT                   GNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTLRFASRSKNVALDVS
FT                   RVYKRINRSAHPFSSPSKLDGGDDRSEQRIQELLIQLQTRDRELAKLREVSAGVASGTM
FT                   NGAQQNLHPDTQLLTKENLLLKNKLKHYESLLVEDGMGVSGASTRNTSNSSSSSTLVSS
FT                   SPALDNKGRYAGTNSTGVDAELEEIAQLLPSEVAVMLETKFDNLRRQLQSAHRYSESLE
FT                   KQLNDSHTETEQLKRSLQTKDKLIEALTSAKRLQQQQ"
     MSASRDSEKY RFETPRVMKS PSPSLDSAVS ISSYARSRSS VTRGFRNGSS SGSSSRSSSP        60
     LRPGSFGGDP YLQYGKIRNR SESSSYENGS GNLDKYTGTI KVVIRPKPYP TEKIVSWKIH       120
     GDKVISHNDI GDFTFDHVFS TGCSNFDIYG KTTQPLIDRL IEGYNATIFA YGMTGSGKTF       180
     TMSGTEEEKG LIPLSVSYLF SSLLEKTNTE NEKSEVWVSY LEIYNEKIND LLDVASGSNV       240
     QNTPSRLFTS THTSSSGDLK IRDDSECGVR VVGLTQKRCD TSEEVLDWIN KGNKNRKTSE       300
     TEFNTRSSRS HAIVMIRLIS KDIRTGEQNI RTLSLCDLAG SERGVGQNER RKEGAFINRS       360
     LLALGTVISR LSAENNGSHH TGRAANSQQS LASPNGSSSG NHIPYRDSKL TRLLQPALSG       420
     DSVVVALCTI DLAHESSSET LNTLRFASRS KNVALDVSRV YKRINRSAHP FSSPSKLDGG       480
     DDRSEQRIQE LLIQLQTRDR ELAKLREVSA GVASGTMNGA QQNLHPDTQL LTKENLLLKN       540
     KLKHYESLLV EDGMGVSGAS TRNTSNSSSS STLVSSSPAL DNKGRYAGTN STGVDAELEE       600
     IAQLLPSEVA VMLETKFDNL RRQLQSAHRY SESLEKQLND SHTETEQLKR SLQTKDKLIE       660
     ALTSAKRLQQ QQ                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page