(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE94

CAGLA1_12.PE94       Location/Qualifiers
FT   CDS             complement(264202..265449)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436724"
FT                   /locus_tag="CAGL0M02211g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG62418.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG590923"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B703B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK02"
FT                   /transl_table=1
FT                   /translation="MRLSLSVLMPLALMLLGDYADAKVFQAELKKEKLTKEMLELGFEA
FT                   HVQQLGHKYVSQYEKANPGTVLPRDHLFYPDQVHNVPLSNYMDAQYFADISLGTPPQKF
FT                   KVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEGYISE
FT                   DNLQIGDLTIQNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDDITPPFYSAIQQHL
FT                   LDESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDLIPLHVRRQAYWEVPLN
FT                   AIKLGDQSTGKLENTGAAIDTGTSLITLPSDMAEIINAQIGAKKGWTGQYTLECSTRAK
FT                   LPDLTFTLDGHDFVLSPFEYTLEVSGSCISVITPMDFPEPIGRMAILGDAFLRRYYSVF
FT                   DLDANVVSLAEAVHSA"
     MRLSLSVLMP LALMLLGDYA DAKVFQAELK KEKLTKEMLE LGFEAHVQQL GHKYVSQYEK        60
     ANPGTVLPRD HLFYPDQVHN VPLSNYMDAQ YFADISLGTP PQKFKVILDT GSSNLWVPSV       120
     DCGSLACFLH NKYDHSQSST YIKDGRPLSI SYGSGSIEGY ISEDNLQIGD LTIQNQKFGE       180
     TTSEPGLAFA FGKFDGILGL AYDTIAQDDI TPPFYSAIQQ HLLDESKFSF YLKSVNDPAA       240
     EGGSASDGGV FTLGGVDSSK FKGDLIPLHV RRQAYWEVPL NAIKLGDQST GKLENTGAAI       300
     DTGTSLITLP SDMAEIINAQ IGAKKGWTGQ YTLECSTRAK LPDLTFTLDG HDFVLSPFEY       360
     TLEVSGSCIS VITPMDFPEP IGRMAILGDA FLRRYYSVFD LDANVVSLAE AVHSA            415
//

If you have problems or comments...

PBIL Back to PBIL home page