(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE95

CAGLA1_12.PE95       Location/Qualifiers
FT   CDS             complement(267332..269635)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436725"
FT                   /locus_tag="CAGL0M02233g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62419.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058433"
FT                   /db_xref="HOGENOM:HBG396675"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016256"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="UniParc:UPI00003B703C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK01"
FT                   /transl_table=1
FT                   /translation="MMETQPTQQATQATQKYLIDNFTQEQIKKNSVYRVICTSGQIPIK
FT                   DMEVDVEQIAKKKESIKKIWTFGRNNACDYHLGNISRLSNKHFQILLGEDGNLLLRDIS
FT                   TNGTWLNNQRIEKDRNHLLSQGDEITVGLGVSSDIISLVIFINEKFRDYLEEVRQELSS
FT                   QGLKVSSKSNANPNINLTGIYKDFSINDEVVGTGAFATVKKAVERNTGKTFAVKIINKR
FT                   KVVGNMDGVSRELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAV
FT                   GEEAGREISRQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS
FT                   IMKTFCGTLAYVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF
FT                   SGSTQEQLYEQIRKGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIK
FT                   QCSSQFDANSMSSQVSLSQSMSQQKALESLDDAQYEFLKAQKKLQQDEPINDKLKDFKV
FT                   PTQPPTRFTQPKVINPIENIKKYTKSVKKKGSGKFMTFKPLPESVIQESFEIKQGINPF
FT                   FIGRSDDCNCRIDDNRLSRVHCFILKKRHPIGKSIYESPAQGLDDIWYCHSGSNDSYVN
FT                   DIRMTPGKKYLLQEGDEIKIIKDKQKDFVIGFQVELNDTTGLFNNGLGIPNEERSVTSQ
FT                   TEDELKLVSRLAKIMAAQRSSTKEANETMDQNRNLLKKVHSVSLSQSITDPSRKVKRAK
FT                   LDQTDHNAENMQFF"
     MMETQPTQQA TQATQKYLID NFTQEQIKKN SVYRVICTSG QIPIKDMEVD VEQIAKKKES        60
     IKKIWTFGRN NACDYHLGNI SRLSNKHFQI LLGEDGNLLL RDISTNGTWL NNQRIEKDRN       120
     HLLSQGDEIT VGLGVSSDII SLVIFINEKF RDYLEEVRQE LSSQGLKVSS KSNANPNINL       180
     TGIYKDFSIN DEVVGTGAFA TVKKAVERNT GKTFAVKIIN KRKVVGNMDG VSRELEVLQK       240
     LNHPRIVSLK AFYEDEANYY MVMEFISGGD LMDFVAAHGA VGEEAGREIS RQILEAIQYI       300
     HSKGISHRDL KPDNILIEQD DPVLVKITDF GLAKVQGNGS IMKTFCGTLA YVAPEVIGGF       360
     TGATGEEETE EERIEYSSLV DMWSMGCLVF VILTGHLPFS GSTQEQLYEQ IRKGSYHEGP       420
     LKDFRISDEA RDFIDGLLQV DQSKRMTVDD ALNHPWIKQC SSQFDANSMS SQVSLSQSMS       480
     QQKALESLDD AQYEFLKAQK KLQQDEPIND KLKDFKVPTQ PPTRFTQPKV INPIENIKKY       540
     TKSVKKKGSG KFMTFKPLPE SVIQESFEIK QGINPFFIGR SDDCNCRIDD NRLSRVHCFI       600
     LKKRHPIGKS IYESPAQGLD DIWYCHSGSN DSYVNDIRMT PGKKYLLQEG DEIKIIKDKQ       660
     KDFVIGFQVE LNDTTGLFNN GLGIPNEERS VTSQTEDELK LVSRLAKIMA AQRSSTKEAN       720
     ETMDQNRNLL KKVHSVSLSQ SITDPSRKVK RAKLDQTDHN AENMQFF                     767
//

If you have problems or comments...

PBIL Back to PBIL home page