(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE96

CAGLA1_12.PE96       Location/Qualifiers
FT   CDS             270614..271690
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436726"
FT                   /gene_name="RRD2"
FT                   /locus_tag="CAGL0M02255g"
FT                   /product="Serine/threonine-protein phosphatase 2A activator
FT                   2"
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="phosphatase activator activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62420.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019211"
FT                   /db_xref="HOGENOM:HBG191557"
FT                   /db_xref="HOGENOM:HBG526297"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="UniParc:UPI00003B703D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK00"
FT                   /transl_table=1
FT                   /translation="MIPSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVS
FT                   EPVSDSVQSTIAVLTEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHF
FT                   PALTSEQIEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVL
FT                   VLFIEYLKIMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKHLKPKSIHNE
FT                   ELVEMFADKYLYFGCIAFINSVKTSTSLRWHSPMLDDISGVKKWSKVAEGMIKMYKAEV
FT                   LGKLPIMQHFYFSEFLVCPEGISEPRTHIHNGDEDDDQCCQDGAAHNTWGDCCGIKIPS
FT                   LYAANAMEKQSHKPIPFD"
     MIPSKRILTD KDVKIWEESE TREDILSFIE SLAKAVEGFE NDQVSEPVSD SVQSTIAVLT        60
     EIDKLIKLHP VIQDKNTSRF GKVEFRDFYD DVCEKADDLL SSHFPALTSE QIEQLSIYLQ       120
     ESWGNKRRID YGSGHELNFI CFLYGLTHYK IFDLQRDARN LVLVLFIEYL KIMREIETLY       180
     WLEPAGSHGV WGLDDYHFLP FLFGAFQLAP HKHLKPKSIH NEELVEMFAD KYLYFGCIAF       240
     INSVKTSTSL RWHSPMLDDI SGVKKWSKVA EGMIKMYKAE VLGKLPIMQH FYFSEFLVCP       300
     EGISEPRTHI HNGDEDDDQC CQDGAAHNTW GDCCGIKIPS LYAANAMEKQ SHKPIPFD         358
//

If you have problems or comments...

PBIL Back to PBIL home page