(data stored in ACNUC7421 zone)

HOGENOMDNA: CLOB6_1.PE1

CLOB6_1.PE1          Location/Qualifiers
FT   CDS             complement(99..410)
FT                   /locus_tag="CLJ_0001"
FT                   /gene_family="HOG000051473" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:229587272"
FT                   /db_xref="GeneID:7816121"
FT                   /translation="MPDIYINFIIKCLDCTIKYAKKISNVLIIVFNELYLFNKKIIITQ
FT                   TVKIVKLFKISFNYTTVLKKEKYDKLKAKEKINLDLNRNVQPGEELIKYIKKKGKMER"
FT                   /protein_id="YP_002860310.1"
     MPDIYINFII KCLDCTIKYA KKISNVLIIV FNELYLFNKK IIITQTVKIV KLFKISFNYT        60
     TVLKKEKYDK LKAKEKINLD LNRNVQPGEE LIKYIKKKGK MER                         103
//

If you have problems or comments...

PBIL Back to PBIL home page