(data stored in ACNUC7421 zone)

HOGENOMDNA: CLOB6_1.PE2

CLOB6_1.PE2          Location/Qualifiers
FT   CDS             complement(828..1448)
FT                   /locus_tag="CLJ_0002"
FT                   /gene_family="HOG000017398" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thermonuclease"
FT                   /EC_number="3.1.31.1"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="GI:229587273"
FT                   /db_xref="GeneID:7816178"
FT                   /translation="MGIKKFIPIILITVLLTGCQNINEATKLSQDVVRDNVSIINNIKG
FT                   NNYPGKNNLSLKKATVYRVIDGDTIILNTGERVRFIGVNCPEDTTKHEDFGREATLYTR
FT                   SMLEDKTVYLEKDISNTDKYGRLLRYVWLEIPESNSDQEINSKMFNSMLLSNGFGQQST
FT                   FPPNVKYVDTFTNCEREARSAKKGLWKINSNGTTNGDIRYKKY"
FT                   /transl_table="11"
FT                   /protein_id="YP_002860311.1"
     MGIKKFIPII LITVLLTGCQ NINEATKLSQ DVVRDNVSII NNIKGNNYPG KNNLSLKKAT        60
     VYRVIDGDTI ILNTGERVRF IGVNCPEDTT KHEDFGREAT LYTRSMLEDK TVYLEKDISN       120
     TDKYGRLLRY VWLEIPESNS DQEINSKMFN SMLLSNGFGQ QSTFPPNVKY VDTFTNCERE       180
     ARSAKKGLWK INSNGTTNGD IRYKKY                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page