(data stored in ACNUC7421 zone)

EMBL: CP000031.AASADH

CP000031.AASADH      Location/Qualifiers
FT   CDS             253400..254914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aasadh"
FT                   /locus_tag="SPO0235"
FT                   /product="alpha-aminoadipic semialdehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93560"
FT                   /db_xref="GOA:Q5LX23"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX23"
FT                   /protein_id="AAV93560.1"
FT                   /translation="MKDIVMTAETVMQQLGLGAADLTGGSIRVTSPIDGRVLGEVHETP
FT                   LSEMAAVLDRAKSAFKIWRSVPAPRRGELIRLLGEELRASKEALGALVSWEAGKITSEG
FT                   LGEVQEMIDICDFAVGLSRQLYGLTIASERPGHRMMETWHPAGPVGVISAFNFPVAVWS
FT                   WNAALAIVCGDPVIWKPSEKTPLTALACQKIFERALARFGDAPDGLLQTLIGGADLGRT
FT                   LVESEDVPIISATGSTRMGRAVAPIVAARFGKCILELGGNNAMIVGPSADLEMAVRAIV
FT                   FSAVGTAGQRCTTLRRLIAHNSIKDELVARLKKAYAGLPIGNPLAEGTLIGPLVDEASG
FT                   NAMTDALKSAKAEGGMVFGGARVSEGVPAGGVYMQPAIVEMPAQSATVKTETFAPILYV
FT                   MGYDSFEEAVHIQNDVPQGLSSCVFTLNMREAEQFLSASGSDCGIANVNIGPSGAEIGG
FT                   AFGGEKETGGGRESGSDAWKAYMRRQTNTVNYSAELPLAQGVKFDI"
     MKDIVMTAET VMQQLGLGAA DLTGGSIRVT SPIDGRVLGE VHETPLSEMA AVLDRAKSAF        60
     KIWRSVPAPR RGELIRLLGE ELRASKEALG ALVSWEAGKI TSEGLGEVQE MIDICDFAVG       120
     LSRQLYGLTI ASERPGHRMM ETWHPAGPVG VISAFNFPVA VWSWNAALAI VCGDPVIWKP       180
     SEKTPLTALA CQKIFERALA RFGDAPDGLL QTLIGGADLG RTLVESEDVP IISATGSTRM       240
     GRAVAPIVAA RFGKCILELG GNNAMIVGPS ADLEMAVRAI VFSAVGTAGQ RCTTLRRLIA       300
     HNSIKDELVA RLKKAYAGLP IGNPLAEGTL IGPLVDEASG NAMTDALKSA KAEGGMVFGG       360
     ARVSEGVPAG GVYMQPAIVE MPAQSATVKT ETFAPILYVM GYDSFEEAVH IQNDVPQGLS       420
     SCVFTLNMRE AEQFLSASGS DCGIANVNIG PSGAEIGGAF GGEKETGGGR ESGSDAWKAY       480
     MRRQTNTVNY SAELPLAQGV KFDI                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page