(data stored in ACNUC9435 zone)

EMBL: CP000031.ACKA

CP000031.ACKA        Location/Qualifiers
FT   CDS             122521..123705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SPO0116"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93446"
FT                   /db_xref="GOA:Q5LWR6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR6"
FT                   /protein_id="AAV93446.1"
FT                   /translation="MTDVVLVLNAGSSSIKFAVYPSGTNTVPLIRGKVAGVGRDPVFSA
FT                   VRADGTAIDMVMPKNIDAAADHEALISLLLDWLAEHRADRRLVAVGHRVVHGGRDFLKP
FT                   VIVDDSVLSQLEQLIPLAPLHQPHNLAAIRAISRLQPTVPQVACFDTSFHQTQDRLAQL
FT                   FALPRDLSDEGIIRYGFHGLSYEYIAGILPDHLGERAEGRVIVAHLGNGASMCAMKNRQ
FT                   SVATSMGFTALDGLMMGRRCGALDAGVVLYLMQSKGLNATEIETLLYRRCGLLGVSGIS
FT                   NNMRELERSDDPKAREAIELFCFRAASVLGGLVTALGGLDAIVFTAGIGENSALVRKLI
FT                   CDRLACFGVDLDPNSNEGNSPRIGSVQSSIDVLVLPTDEEIVISNATNETVALG"
     MTDVVLVLNA GSSSIKFAVY PSGTNTVPLI RGKVAGVGRD PVFSAVRADG TAIDMVMPKN        60
     IDAAADHEAL ISLLLDWLAE HRADRRLVAV GHRVVHGGRD FLKPVIVDDS VLSQLEQLIP       120
     LAPLHQPHNL AAIRAISRLQ PTVPQVACFD TSFHQTQDRL AQLFALPRDL SDEGIIRYGF       180
     HGLSYEYIAG ILPDHLGERA EGRVIVAHLG NGASMCAMKN RQSVATSMGF TALDGLMMGR       240
     RCGALDAGVV LYLMQSKGLN ATEIETLLYR RCGLLGVSGI SNNMRELERS DDPKAREAIE       300
     LFCFRAASVL GGLVTALGGL DAIVFTAGIG ENSALVRKLI CDRLACFGVD LDPNSNEGNS       360
     PRIGSVQSSI DVLVLPTDEE IVISNATNET VALG                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page