(data stored in ACNUC7421 zone)

EMBL: CP000031.ARGB

CP000031.ARGB        Location/Qualifiers
FT   CDS             complement(522016..522879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="SPO0526"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93843"
FT                   /db_xref="GOA:Q5LW17"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LW17"
FT                   /protein_id="AAV93843.1"
FT                   /translation="MKTRDMNRDWIATAATLNAALPYLQRYDDAIVVIKLGGHAMGSDE
FT                   AMESFARDVVLLRQVGVNPVVVHGGGPMINAMLKKLDIQSEFVNGKRVTDVATVEVVEM
FT                   VLSGVVNKRIVQEINRQGGKAVGLSGKDANLMICDQTNPDLGFVGTPTEMNPDLLRNLF
FT                   AHDIIPVIAPLGAGREGETFNVNGDTAAGAIAAALKADRLLLLTDVSGVKNGEGEVLTE
FT                   LKAGQIREMIADGTIAGGMIPKTETALDALDNGVRAVVILDGRVDNAVLLELYTEHGAG
FT                   SLIRRD"
     MKTRDMNRDW IATAATLNAA LPYLQRYDDA IVVIKLGGHA MGSDEAMESF ARDVVLLRQV        60
     GVNPVVVHGG GPMINAMLKK LDIQSEFVNG KRVTDVATVE VVEMVLSGVV NKRIVQEINR       120
     QGGKAVGLSG KDANLMICDQ TNPDLGFVGT PTEMNPDLLR NLFAHDIIPV IAPLGAGREG       180
     ETFNVNGDTA AGAIAAALKA DRLLLLTDVS GVKNGEGEVL TELKAGQIRE MIADGTIAGG       240
     MIPKTETALD ALDNGVRAVV ILDGRVDNAV LLELYTEHGA GSLIRRD                     287
//

If you have problems or comments...

PBIL Back to PBIL home page