(data stored in ACNUC9435 zone)

EMBL: CP000031.ARGG

CP000031.ARGG        Location/Qualifiers
FT   CDS             complement(17129..18358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="SPO0018"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93349"
FT                   /db_xref="GOA:Q5LWG3"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWG3"
FT                   /protein_id="AAV93349.1"
FT                   /translation="MSAPKKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQGEEL
FT                   EPARKKAELLGIKPENIHIEDVREEFVRDFVFPMFRANAVYEGLYLLGTSIARPLISKR
FT                   LVEIAAEHGADAVAHGATGKGNDQVRFELSAYALNPEIRVIAPWRLWDLTSRTRLLEFA
FT                   EAHQIPISKDKRGEAPFSVDANLLHTSSEGKVLEDPGVEAPDYVAQRIVAVEDAPDTPE
FT                   FIEVTFEKGDAVAINGEAMSPATILTRLNELGGKHGIGLLDFVENRFVGMKSRGVYETP
FT                   GGTILLEAHRGIEQITLDSGAGHLKDSIMPRYAELIYNGFWFSPEREMLQALIDKSQEH
FT                   VTGTVRLKLYKGSARTVARWSDHSLYSEAHVTFEEDAGAYDQQDAKGFIQLNALRLKLL
FT                   ATRNRRVAGK"
     MSAPKKVVLA YSGGLDTSII LKWLQTEYGC EVVTFTADLG QGEELEPARK KAELLGIKPE        60
     NIHIEDVREE FVRDFVFPMF RANAVYEGLY LLGTSIARPL ISKRLVEIAA EHGADAVAHG       120
     ATGKGNDQVR FELSAYALNP EIRVIAPWRL WDLTSRTRLL EFAEAHQIPI SKDKRGEAPF       180
     SVDANLLHTS SEGKVLEDPG VEAPDYVAQR IVAVEDAPDT PEFIEVTFEK GDAVAINGEA       240
     MSPATILTRL NELGGKHGIG LLDFVENRFV GMKSRGVYET PGGTILLEAH RGIEQITLDS       300
     GAGHLKDSIM PRYAELIYNG FWFSPEREML QALIDKSQEH VTGTVRLKLY KGSARTVARW       360
     SDHSLYSEAH VTFEEDAGAY DQQDAKGFIQ LNALRLKLLA TRNRRVAGK                   409
//

If you have problems or comments...

PBIL Back to PBIL home page