(data stored in ACNUC9435 zone)

EMBL: CP000031.ARGH

CP000031.ARGH        Location/Qualifiers
FT   CDS             342602..343993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="SPO0332"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by similarity to SP:P59615; match to
FT                   protein family HMM PF00206; match to protein family HMM
FT                   TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93650"
FT                   /db_xref="GOA:Q5LXC0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LXC0"
FT                   /protein_id="AAV93650.1"
FT                   /translation="MTDKTSNQMWGGRFAAGPDAIMEAINASIGFDKRLAAQDIAGSRA
FT                   HAAMLAATGVITDSDAEAIREGLLTVLSEIEAGEFTFSTALEDIHMNVEARLKEIIGEP
FT                   AGRLHTARSRNDQVATDFKLWVRDQFDAAEAGLLALLRALLGQAEAGADWVMPGFTHLQ
FT                   TAQPVTWGHHMMAYVEMFGRDLSRVRDARARMNESPLGSAALAGTSFPIDRHMTAAALG
FT                   FDRPTANSLDAVSDRDFALEFLSVASICAMHLSRFAEELVIWSSAQFRFVTLSDRFSTG
FT                   SSIMPQKKNPDAAELIRAKVGRIFGANTALMMVMKGLPLAYSKDMQEDKEQVFDAADNW
FT                   MLALAAMEGMVRDMTANRDSLAAAAGSGFSTATDLADWLVRVLGLPFRDAHHVTGALVA
FT                   LAESKGCDLPDLSLDEMQSAHAAITEDVYGVLGVENSVNSRQSYGGTAPAQVRAQVARW
FT                   KEMLA"
     MTDKTSNQMW GGRFAAGPDA IMEAINASIG FDKRLAAQDI AGSRAHAAML AATGVITDSD        60
     AEAIREGLLT VLSEIEAGEF TFSTALEDIH MNVEARLKEI IGEPAGRLHT ARSRNDQVAT       120
     DFKLWVRDQF DAAEAGLLAL LRALLGQAEA GADWVMPGFT HLQTAQPVTW GHHMMAYVEM       180
     FGRDLSRVRD ARARMNESPL GSAALAGTSF PIDRHMTAAA LGFDRPTANS LDAVSDRDFA       240
     LEFLSVASIC AMHLSRFAEE LVIWSSAQFR FVTLSDRFST GSSIMPQKKN PDAAELIRAK       300
     VGRIFGANTA LMMVMKGLPL AYSKDMQEDK EQVFDAADNW MLALAAMEGM VRDMTANRDS       360
     LAAAAGSGFS TATDLADWLV RVLGLPFRDA HHVTGALVAL AESKGCDLPD LSLDEMQSAH       420
     AAITEDVYGV LGVENSVNSR QSYGGTAPAQ VRAQVARWKE MLA                         463
//

If you have problems or comments...

PBIL Back to PBIL home page