(data stored in ACNUC7421 zone)

EMBL: CP000031.ARGJ

CP000031.ARGJ        Location/Qualifiers
FT   CDS             60750..61976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="SPO0059"
FT                   /product="glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /note="identified by similarity to SP:P38434; match to
FT                   protein family HMM PF01960; match to protein family HMM
FT                   TIGR00120"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93390"
FT                   /db_xref="GOA:Q5LWL6"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWL6"
FT                   /protein_id="AAV93390.1"
FT                   /translation="MAKITKVSPLAPAAFPTLPVIDGVRLASIAAGVRYQGRTDVMLAV
FT                   LDPGTSVAGVFTRSATRSAPVLDCQAKIGGASDGPAAILVNSGNSNAFTGHYGQTSVAE
FT                   VTQAVADVTGVPVGRVFTSSTGVIGEPMKHERIVAKLGDLNAALSPDALEDAARAIMTT
FT                   DTFAKGASRTVGIDGKMVKIAGIAKGSGMIAPDMATMLVYIFTDARVEQGALQAMLSAM
FT                   TDKTFNCITVDSDTSTSDTLLLCATGASGVDAEGNAEFAAALEAVMLDLAQQVVRDGEG
FT                   ATKFVEIRVTGAANDVDAKVHGLAIANSPLVKTAIAGEDPNWGRVVMAIGKSGAAADRD
FT                   LLSISFGDILVAEKGWVSPNYREEDAAAYMKGQDLVIGVDLGLGAGKSTVWTCDLTHGY
FT                   IEINADYRS"
     MAKITKVSPL APAAFPTLPV IDGVRLASIA AGVRYQGRTD VMLAVLDPGT SVAGVFTRSA        60
     TRSAPVLDCQ AKIGGASDGP AAILVNSGNS NAFTGHYGQT SVAEVTQAVA DVTGVPVGRV       120
     FTSSTGVIGE PMKHERIVAK LGDLNAALSP DALEDAARAI MTTDTFAKGA SRTVGIDGKM       180
     VKIAGIAKGS GMIAPDMATM LVYIFTDARV EQGALQAMLS AMTDKTFNCI TVDSDTSTSD       240
     TLLLCATGAS GVDAEGNAEF AAALEAVMLD LAQQVVRDGE GATKFVEIRV TGAANDVDAK       300
     VHGLAIANSP LVKTAIAGED PNWGRVVMAI GKSGAAADRD LLSISFGDIL VAEKGWVSPN       360
     YREEDAAAYM KGQDLVIGVD LGLGAGKSTV WTCDLTHGYI EINADYRS                    408
//

If you have problems or comments...

PBIL Back to PBIL home page