(data stored in ACNUC7421 zone)

EMBL: CP000031.AROC

CP000031.AROC        Location/Qualifiers
FT   CDS             complement(284706..285806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="SPO0267"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by similarity to SP:P12008; match to
FT                   protein family HMM PF01264; match to protein family HMM
FT                   TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93587"
FT                   /db_xref="GOA:Q5LX60"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX60"
FT                   /protein_id="AAV93587.1"
FT                   /translation="MSMNSFGHLFRVTTWGESHGPALGATVDGCPPGVPIEEAMIQHWL
FT                   DRRKPGQNKYTTQRREADEVKILSGVFEGQTTGTPVQLMIENTDQRSKDYGDIKDKFRP
FT                   GHADITYFQKYGIRDYRGGGRSSARETAARVAAGGLAREAIRALAPNAQITGYMVQMGP
FT                   HRIDRARFDWAQIEQNPFWVPDAQAASDWADYLDGLRKSGSSVGAVIEVVARGVPAGLG
FT                   APVYGKLDTDLAAAMMSINAVKGVEIGEGMAAAELTGEANADEIFMGQNGPQYSSNHAG
FT                   GILGGISTGQDIVVRFAVKPTSSILTTRKTITKSGEETEIITKGRHDPCVGIRAVPVGE
FT                   AMMACVILDHLLLHRGQIGANRGHIG"
     MSMNSFGHLF RVTTWGESHG PALGATVDGC PPGVPIEEAM IQHWLDRRKP GQNKYTTQRR        60
     EADEVKILSG VFEGQTTGTP VQLMIENTDQ RSKDYGDIKD KFRPGHADIT YFQKYGIRDY       120
     RGGGRSSARE TAARVAAGGL AREAIRALAP NAQITGYMVQ MGPHRIDRAR FDWAQIEQNP       180
     FWVPDAQAAS DWADYLDGLR KSGSSVGAVI EVVARGVPAG LGAPVYGKLD TDLAAAMMSI       240
     NAVKGVEIGE GMAAAELTGE ANADEIFMGQ NGPQYSSNHA GGILGGISTG QDIVVRFAVK       300
     PTSSILTTRK TITKSGEETE IITKGRHDPC VGIRAVPVGE AMMACVILDH LLLHRGQIGA       360
     NRGHIG                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page