(data stored in ACNUC9435 zone)

EMBL: CP000031.BETB

CP000031.BETB        Location/Qualifiers
FT   CDS             complement(82247..83701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="SPO0084"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="identified by similarity to SP:P54222; match to
FT                   protein family HMM PF00171; match to protein family HMM
FT                   TIGR01804"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93415"
FT                   /db_xref="GOA:Q5LWM7"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM7"
FT                   /protein_id="AAV93415.1"
FT                   /translation="MKFQPEASHFINGAYVEDTAGAVIDVIYPATGEVIARLHSATPAI
FT                   IDQALEAARQAQAQWAAMTGTERGRILRRAADIMRARNHDLSVIETHDTGKPIQETTVA
FT                   DATSGADALEYFGGLAGSLTGEHIPLGGGDFAYTVREALGVCVGIGAWNYPTQIACWKG
FT                   APALACGNTMVFKPSETTPLSALKVAEILIEAGAPKGIYNVVQGYGDVGASLVTDPRVA
FT                   KVSLTGSVPTGRRVYAAAAESIKHVTMELGGKSPLVVFDDADIENAVSGAILGNFYSSG
FT                   QVCSNGTRVFVQKGIKEAFLSRLAERLATAVIGDPMDPATNFGPMVSEAQMNIVLGYVD
FT                   KGKAEGARLVYGGTRLDRDGFYLLPTVFADVTDDMTIAREEIFGPVMSVLDFDTEEEVL
FT                   ERANATEFGLAAGVFTRDITRAHRMVAGFEAGTCYINSYNLAPVEAPFGGSKQSGVGRE
FT                   NSKLAINHFSEMKTVFVSMNDIQAPY"
     MKFQPEASHF INGAYVEDTA GAVIDVIYPA TGEVIARLHS ATPAIIDQAL EAARQAQAQW        60
     AAMTGTERGR ILRRAADIMR ARNHDLSVIE THDTGKPIQE TTVADATSGA DALEYFGGLA       120
     GSLTGEHIPL GGGDFAYTVR EALGVCVGIG AWNYPTQIAC WKGAPALACG NTMVFKPSET       180
     TPLSALKVAE ILIEAGAPKG IYNVVQGYGD VGASLVTDPR VAKVSLTGSV PTGRRVYAAA       240
     AESIKHVTME LGGKSPLVVF DDADIENAVS GAILGNFYSS GQVCSNGTRV FVQKGIKEAF       300
     LSRLAERLAT AVIGDPMDPA TNFGPMVSEA QMNIVLGYVD KGKAEGARLV YGGTRLDRDG       360
     FYLLPTVFAD VTDDMTIARE EIFGPVMSVL DFDTEEEVLE RANATEFGLA AGVFTRDITR       420
     AHRMVAGFEA GTCYINSYNL APVEAPFGGS KQSGVGRENS KLAINHFSEM KTVFVSMNDI       480
     QAPY                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page