(data stored in ACNUC7421 zone)

EMBL: CP000031.BPHC3

CP000031.BPHC3       Location/Qualifiers
FT   CDS             complement(403532..404017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bphC3"
FT                   /locus_tag="SPO0391"
FT                   /product="biphenyl-2,3-diol 1,2-dioxygenase III"
FT                   /EC_number="1.13.11.39"
FT                   /note="identified by similarity to SP:P47233; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93709"
FT                   /db_xref="GOA:Q5LXH2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH2"
FT                   /protein_id="AAV93709.1"
FT                   /translation="MTYSAPAGTCVGHVHLKVSDLDRAIAFYRDVLGFEVQQRYGDAAA
FT                   FLGAGGYHHHIGLNTWHSRGGPQPPARATGLYHSAFLYPDRKALGTVLRQVIEAGIPID
FT                   GSADHGVSEAVYLRDPDGNGVELYRDRAPEDWPRDGEGNLAMTNAPLDIPALLAEAG"
     MTYSAPAGTC VGHVHLKVSD LDRAIAFYRD VLGFEVQQRY GDAAAFLGAG GYHHHIGLNT        60
     WHSRGGPQPP ARATGLYHSA FLYPDRKALG TVLRQVIEAG IPIDGSADHG VSEAVYLRDP       120
     DGNGVELYRD RAPEDWPRDG EGNLAMTNAP LDIPALLAEA G                           161
//

If you have problems or comments...

PBIL Back to PBIL home page