(data stored in ACNUC7421 zone)

EMBL: CP000031.CCPA

CP000031.CCPA        Location/Qualifiers
FT   CDS             340918..341967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="SPO0330"
FT                   /product="cytochrome c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="identified by similarity to SP:P14532; match to
FT                   protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93648"
FT                   /db_xref="GOA:Q5LXC2"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC2"
FT                   /protein_id="AAV93648.1"
FT                   /translation="MSPKSLFSFSLTALSCTAGLAAANPLREQALELFQPLPSTVPAVK
FT                   DNPITPEKIDLGKALFFDPRMSASGVFSCNSCHNLATGGDDNLETSIGHGWQKGPRNAP
FT                   TVLNAVFNAAQFWDGRAPDLAEQAKGPVQAGVEMANTPGQVVATLNSMPEYVAWFQAAF
FT                   PDQPDPVSFDSFAKAIEAYEATLITPAPFDAWLNGDDAALSGEQKQGLSLFIDAGCASC
FT                   HGGVNLGGQDYYPFGLVETPDAEVLPSGDKGRFAVTATEDDEYVFRAAPLRNIAVTAPY
FT                   FHSGKVWELEAAVSIMASSQLGADLSEEETAAITAFLHSLTGEVPQVVYPVLPAETSGT
FT                   PRPDGAVQR"
     MSPKSLFSFS LTALSCTAGL AAANPLREQA LELFQPLPST VPAVKDNPIT PEKIDLGKAL        60
     FFDPRMSASG VFSCNSCHNL ATGGDDNLET SIGHGWQKGP RNAPTVLNAV FNAAQFWDGR       120
     APDLAEQAKG PVQAGVEMAN TPGQVVATLN SMPEYVAWFQ AAFPDQPDPV SFDSFAKAIE       180
     AYEATLITPA PFDAWLNGDD AALSGEQKQG LSLFIDAGCA SCHGGVNLGG QDYYPFGLVE       240
     TPDAEVLPSG DKGRFAVTAT EDDEYVFRAA PLRNIAVTAP YFHSGKVWEL EAAVSIMASS       300
     QLGADLSEEE TAAITAFLHS LTGEVPQVVY PVLPAETSGT PRPDGAVQR                   349
//

If you have problems or comments...

PBIL Back to PBIL home page