(data stored in ACNUC7421 zone)

EMBL: CP000031.CITE

CP000031.CITE        Location/Qualifiers
FT   CDS             366147..367004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="SPO0352"
FT                   /product="citrate lyase, beta subunit"
FT                   /EC_number="4.1.3.34"
FT                   /EC_number="4.1.3.6"
FT                   /note="identified by similarity to SP:P77770"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93670"
FT                   /db_xref="GOA:Q5LXD8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD8"
FT                   /protein_id="AAV93670.1"
FT                   /translation="MDPRQRPYRSVLYIPGSKERALDKARSLPVDAIIFDLEDAVAADE
FT                   KDNARETLKAALAQGGYGARVKIVRINGLDTPWGHADAEAVRDMDADVVLLPKVGGAAD
FT                   VDALAAITGDLPIWAMMETPRGMLNAAQIAAHPLLTGFVMGTNDLAKELQTRFRADRLP
FT                   MMSSLGLCLLAAKAEGLIAIDGVYNAFKDGEGLAAECAQGRDMGFDGKTLIHPAQVEIA
FT                   NTAFAPSEAEIDLARRQIAAFAEVEASGQGVAVVDGKIVENLHVATAREVLAKAEAILA
FT                   LQAG"
     MDPRQRPYRS VLYIPGSKER ALDKARSLPV DAIIFDLEDA VAADEKDNAR ETLKAALAQG        60
     GYGARVKIVR INGLDTPWGH ADAEAVRDMD ADVVLLPKVG GAADVDALAA ITGDLPIWAM       120
     METPRGMLNA AQIAAHPLLT GFVMGTNDLA KELQTRFRAD RLPMMSSLGL CLLAAKAEGL       180
     IAIDGVYNAF KDGEGLAAEC AQGRDMGFDG KTLIHPAQVE IANTAFAPSE AEIDLARRQI       240
     AAFAEVEASG QGVAVVDGKI VENLHVATAR EVLAKAEAIL ALQAG                       285
//

If you have problems or comments...

PBIL Back to PBIL home page