(data stored in ACNUC9435 zone)

EMBL: CP000031.COABC

CP000031.COABC       Location/Qualifiers
FT   CDS             420163..421359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="SPO0408"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM PF04127; match to protein
FT                   family HMM TIGR00521"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93726"
FT                   /db_xref="GOA:Q5LWD4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD4"
FT                   /protein_id="AAV93726.1"
FT                   /translation="MLASKRILLIIGGGIAAYKTLDLIRRLRERGAAVTPVLTGAAEEF
FT                   VTPLSVSALAGEKVYRALFDLTDEAEMGHIQLSRSADLVVVAPATADLMGKMAAGLAND
FT                   LASTLLMATDTPVLIAPAMNVRMWQHPATRRNHAQLAADGIRFIGPNEGDMACGEYGPG
FT                   RMSEPLEIVAAIEAALGDGPLKGKRVLVTSGPTHEPIDPVRYIANRSSGAQGTAVARAL
FT                   AALGAEVVFVTGPADVPPPDGVEVVRVQSAREMDAAVDAALPVDAGVFAAAVADWRVAS
FT                   ASDRKLKKSRDGLPVLEFAENPDILKRVSRMEAGRPPLVVGFAAETNDVIENATAKRLR
FT                   KGCDWIVANDVSPATGIMGGSENAVILITGEGAEEWPRMSKEAVADRLARRIAETLVG"
     MLASKRILLI IGGGIAAYKT LDLIRRLRER GAAVTPVLTG AAEEFVTPLS VSALAGEKVY        60
     RALFDLTDEA EMGHIQLSRS ADLVVVAPAT ADLMGKMAAG LANDLASTLL MATDTPVLIA       120
     PAMNVRMWQH PATRRNHAQL AADGIRFIGP NEGDMACGEY GPGRMSEPLE IVAAIEAALG       180
     DGPLKGKRVL VTSGPTHEPI DPVRYIANRS SGAQGTAVAR ALAALGAEVV FVTGPADVPP       240
     PDGVEVVRVQ SAREMDAAVD AALPVDAGVF AAAVADWRVA SASDRKLKKS RDGLPVLEFA       300
     ENPDILKRVS RMEAGRPPLV VGFAAETNDV IENATAKRLR KGCDWIVAND VSPATGIMGG       360
     SENAVILITG EGAEEWPRMS KEAVADRLAR RIAETLVG                               398
//

If you have problems or comments...

PBIL Back to PBIL home page