(data stored in ACNUC7421 zone)

EMBL: CP000031.COBO

CP000031.COBO        Location/Qualifiers
FT   CDS             complement(280092..280691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="SPO0262"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="identified by match to protein family HMM PF02572;
FT                   match to protein family HMM TIGR00708"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93582"
FT                   /db_xref="GOA:Q5LX46"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX46"
FT                   /protein_id="AAV93582.1"
FT                   /translation="MTDAQDHKEKMKAVQAEHRKKVSEAVDPGRGLVLINTGKGKGKSS
FT                   AAFGVVIRALGWGQKVAVVQFIKGKWKTGERRFFEEHNLVTWHTMGEGFTWDTQDRDRD
FT                   IAAATAAFGKARELMESGDYDLVVLDEINIALRYEYLSVDTVLDGLQARSDRTSVFLTG
FT                   RDAPQALRDYADLVTEMTVEKHPFEAGIKAQRGVDF"
     MTDAQDHKEK MKAVQAEHRK KVSEAVDPGR GLVLINTGKG KGKSSAAFGV VIRALGWGQK        60
     VAVVQFIKGK WKTGERRFFE EHNLVTWHTM GEGFTWDTQD RDRDIAAATA AFGKARELME       120
     SGDYDLVVLD EINIALRYEY LSVDTVLDGL QARSDRTSVF LTGRDAPQAL RDYADLVTEM       180
     TVEKHPFEAG IKAQRGVDF                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page