(data stored in ACNUC7421 zone)

EMBL: CP000031.DACB

CP000031.DACB        Location/Qualifiers
FT   CDS             461960..463450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="SPO0451"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF02113;
FT                   match to protein family HMM TIGR00666"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93769"
FT                   /db_xref="GOA:Q5LW91"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LW91"
FT                   /protein_id="AAV93769.1"
FT                   /translation="MVEAISRRVFLAGLGAALSHSAAYAEAPALSLRPPLRLKDARALA
FT                   GPEAVLSGSGLSGRVAFAVADAETGLELETVEPGLALPPASVAKALTALYALETLGPSH
FT                   RFRTRVLADGPVENGVLKGDLILAGGGDPTLDTDALAALVRALKESGLREVRGAFKVYD
FT                   GSLPEVFSIDPEQPEHVGYSPAVSGIALNFNRVHFEWKRAGKGWSVSMDARSAKIRPAV
FT                   AIAEMKVVSRALPIYTYEQRQRIDSWTVASQALGQDGSRWLPVRKPALYAGDVLQTLAR
FT                   SNGIVLGRVEVVKSLPGGARTLVHHDSAPLEDILRDMLKYSTNLTAEMVGLAATVARGK
FT                   RPATLRASAEEMSVWAAERYGLRGSRLVDHSGLGDASRMTARDLVAILVQAGKTGRLPR
FT                   MLKDIPMRDQKGRVVKGHPIKVAAKTGTLNFVSGLGGFMTAADGTVLAFAILTADPDRR
FT                   AAIPPEDRERPEGARGWNARSKKLQQALIERWGAIYGS"
     MVEAISRRVF LAGLGAALSH SAAYAEAPAL SLRPPLRLKD ARALAGPEAV LSGSGLSGRV        60
     AFAVADAETG LELETVEPGL ALPPASVAKA LTALYALETL GPSHRFRTRV LADGPVENGV       120
     LKGDLILAGG GDPTLDTDAL AALVRALKES GLREVRGAFK VYDGSLPEVF SIDPEQPEHV       180
     GYSPAVSGIA LNFNRVHFEW KRAGKGWSVS MDARSAKIRP AVAIAEMKVV SRALPIYTYE       240
     QRQRIDSWTV ASQALGQDGS RWLPVRKPAL YAGDVLQTLA RSNGIVLGRV EVVKSLPGGA       300
     RTLVHHDSAP LEDILRDMLK YSTNLTAEMV GLAATVARGK RPATLRASAE EMSVWAAERY       360
     GLRGSRLVDH SGLGDASRMT ARDLVAILVQ AGKTGRLPRM LKDIPMRDQK GRVVKGHPIK       420
     VAAKTGTLNF VSGLGGFMTA ADGTVLAFAI LTADPDRRAA IPPEDRERPE GARGWNARSK       480
     KLQQALIERW GAIYGS                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page