(data stored in ACNUC7421 zone)

EMBL: CP000031.DAPF

CP000031.DAPF        Location/Qualifiers
FT   CDS             complement(293884..294693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="SPO0278"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by similarity to SP:P08885; match to
FT                   protein family HMM PF01678; match to protein family HMM
FT                   TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93597"
FT                   /db_xref="GOA:Q5LX66"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX66"
FT                   /protein_id="AAV93597.1"
FT                   /translation="MTFMKMHGLGNDFVVVDARLHPVRITGALARGIAHRHLGVGFDQL
FT                   AVIEPGKGDAHLVFYNADGSTSAACGNATRCIARHLMDETGKTELHLTTDRGDLYARDA
FT                   GDGLTSVNMGAPQLLWHEIPLAEEMDTLELPIEGGPTATGMGNPHCTFFVADAEAIPLA
FT                   EFGARYEHHPLYPQRTNLQVAQITGPDRIRMRVWERGVGITLASGSSSCATAVAAARRG
FT                   LTGRKVQIDLDGGTIWIDWREDGVWMTGPTMHVFSATLTPEFLASLG"
     MTFMKMHGLG NDFVVVDARL HPVRITGALA RGIAHRHLGV GFDQLAVIEP GKGDAHLVFY        60
     NADGSTSAAC GNATRCIARH LMDETGKTEL HLTTDRGDLY ARDAGDGLTS VNMGAPQLLW       120
     HEIPLAEEMD TLELPIEGGP TATGMGNPHC TFFVADAEAI PLAEFGARYE HHPLYPQRTN       180
     LQVAQITGPD RIRMRVWERG VGITLASGSS SCATAVAAAR RGLTGRKVQI DLDGGTIWID       240
     WREDGVWMTG PTMHVFSATL TPEFLASLG                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page