(data stored in ACNUC7421 zone)

EMBL: CP000031.DDSA

CP000031.DDSA        Location/Qualifiers
FT   CDS             complement(331351..332349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddsA"
FT                   /locus_tag="SPO0319"
FT                   /product="decaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by similarity to GB:CAD24417.1; match to
FT                   protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93637"
FT                   /db_xref="GOA:Q5LX97"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX97"
FT                   /protein_id="AAV93637.1"
FT                   /translation="MDAKVSTKPHEMLAATLSQEMAAVNALIRTRMASEHAPRIPEVTA
FT                   HLVEAGGKRLRPMLTLAAARLCGYQGEDHVKLAATVEFIHTATLLHDDVVDESGQRRGR
FT                   PTANLLWDNKSSVLVGDYLFARSFQLMVETGSLRVLDILANAAATIAEGEVLQMTAASD
FT                   LRTDESVYLQVVRGKTAALFSAATEVGGVIAGVPEAQVRALFEYGDALGIAFQIADDLL
FT                   DYQGDAKATGKNVGDDFRERKLTLPVIKAVAQATDEERAFWVRTIEKGKQAEGDLEQAL
FT                   ALMEKYGTLAATRADAHAWAEKARTALELLPNHEIRTMLSDLADYVVARLS"
     MDAKVSTKPH EMLAATLSQE MAAVNALIRT RMASEHAPRI PEVTAHLVEA GGKRLRPMLT        60
     LAAARLCGYQ GEDHVKLAAT VEFIHTATLL HDDVVDESGQ RRGRPTANLL WDNKSSVLVG       120
     DYLFARSFQL MVETGSLRVL DILANAAATI AEGEVLQMTA ASDLRTDESV YLQVVRGKTA       180
     ALFSAATEVG GVIAGVPEAQ VRALFEYGDA LGIAFQIADD LLDYQGDAKA TGKNVGDDFR       240
     ERKLTLPVIK AVAQATDEER AFWVRTIEKG KQAEGDLEQA LALMEKYGTL AATRADAHAW       300
     AEKARTALEL LPNHEIRTML SDLADYVVAR LS                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page