(data stored in ACNUC7421 zone)

EMBL: CP000031.DNAN

CP000031.DNAN        Location/Qualifiers
FT   CDS             165999..167117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SPO0150"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93478"
FT                   /db_xref="GOA:Q5LWV3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV3"
FT                   /protein_id="AAV93478.1"
FT                   /translation="MKISIERGALLKAVAQAQSVVERRNTIPILANVLIEAEGEGAQFR
FT                   ATDLDIEVVDKAPAMIERAGATTVSATTLHEIVRKLPDGALVTLTADAAAGRLTVEAGR
FT                   SNFSLATLPREDFPVMASSEYQSNFTANAAVLRRLFDKSKFAISTEETRYYLNGVYMHV
FT                   ADGDGGKVLRCVATDGHRLARIDADLPAGATDMPGVIVPRKTVGELRKLLDDDEMDIAV
FT                   SVSETKVRFATPDITLTSKVIDGTFPDYTRVIPQANTRRLEVDASEFAKAVDRVATVSS
FT                   ERSRAVKLQLDEDKLVLSVNAPDSGAAEEELAVAYSDERLEIGFNAKYLLEIASQVDRE
FT                   NAVFLFNSSGDPTLMREGNDQSAVYVVMPMRV"
     MKISIERGAL LKAVAQAQSV VERRNTIPIL ANVLIEAEGE GAQFRATDLD IEVVDKAPAM        60
     IERAGATTVS ATTLHEIVRK LPDGALVTLT ADAAAGRLTV EAGRSNFSLA TLPREDFPVM       120
     ASSEYQSNFT ANAAVLRRLF DKSKFAISTE ETRYYLNGVY MHVADGDGGK VLRCVATDGH       180
     RLARIDADLP AGATDMPGVI VPRKTVGELR KLLDDDEMDI AVSVSETKVR FATPDITLTS       240
     KVIDGTFPDY TRVIPQANTR RLEVDASEFA KAVDRVATVS SERSRAVKLQ LDEDKLVLSV       300
     NAPDSGAAEE ELAVAYSDER LEIGFNAKYL LEIASQVDRE NAVFLFNSSG DPTLMREGND       360
     QSAVYVVMPM RV                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page