(data stored in ACNUC7421 zone)

EMBL: CP000031.DUT

CP000031.DUT         Location/Qualifiers
FT   CDS             421423..421878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="SPO0409"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by match to protein family HMM PF00692;
FT                   match to protein family HMM TIGR00576"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93727"
FT                   /db_xref="GOA:Q5LWD3"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWD3"
FT                   /protein_id="AAV93727.1"
FT                   /translation="MVAIRVIRDAGADTQVPLPSYETTGAAGADIRANLPDRGSLTLAP
FT                   GGRALIPTGLRVEIPAGYEIQIRPRSGLALKHGITLPNTPGTIDSDYRGPLGVILLNAG
FT                   AEPFEVVHGERIAQLVVAPVVQARFELTEALGETERGAGGFGSTGRG"
     MVAIRVIRDA GADTQVPLPS YETTGAAGAD IRANLPDRGS LTLAPGGRAL IPTGLRVEIP        60
     AGYEIQIRPR SGLALKHGIT LPNTPGTIDS DYRGPLGVIL LNAGAEPFEV VHGERIAQLV       120
     VAPVVQARFE LTEALGETER GAGGFGSTGR G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page